y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_103975g0010 |
Family | AA2 |
Protein Properties | Length: 111 Molecular Weight: 12117.8 Isoelectric Point: 6.9559 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 1 | 110 | 1.5e-29 |
MLRLALHDAGTYDATTKTGGANGSIRNEEELNHGANNGLKIEIALCEPIKAKYQNITYAEIYQLVGVVVVEVTIGSTVDFVPRRKDSLVSPREGRLPDAK KGTHHLSDVF |
Full Sequence |
---|
Protein Sequence Length: 111 Download |
MLRLALHDAG TYDATTKTGG ANGSIRNEEE LNHGANNGLK IEIALCEPIK AKYQNITYAE 60 IYQLVGVVVV EVTIGSTVDF VPRRKDSLVS PREGRLPDAK KGTHHLSDVF L 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 4.0e-17 | 1 | 110 | 119 | + Peroxidase. | ||
PLN02364 | PLN02364 | 5.0e-25 | 1 | 110 | 110 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 2.0e-27 | 1 | 110 | 110 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 2.0e-46 | 1 | 110 | 113 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02608 | PLN02608 | 1.0e-54 | 1 | 110 | 110 | + L-ascorbate peroxidase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD43334.1 | 0 | 1 | 110 | 34 | 143 | AF159254_1 ascorbate peroxidase [Zantedeschia aethiopica] |
GenBank | ABK21917.1 | 0 | 1 | 110 | 35 | 144 | unknown [Picea sitchensis] |
GenBank | ABK22483.1 | 0 | 1 | 110 | 35 | 144 | unknown [Picea sitchensis] |
GenBank | ACR83571.1 | 0 | 1 | 110 | 5 | 114 | pAPX [Solanum nigrum] |
GenBank | ACU24524.1 | 0 | 1 | 110 | 35 | 144 | unknown [Glycine max] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 2e-38 | 1 | 110 | 35 | 144 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 2e-38 | 1 | 110 | 35 | 144 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 2e-38 | 1 | 110 | 35 | 144 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 2e-38 | 1 | 110 | 35 | 144 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 2xj6_A | 8e-38 | 1 | 110 | 35 | 144 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX397843 | 110 | 1 | 110 | 0 |
GT886868 | 110 | 1 | 110 | 0 |
EX405512 | 110 | 1 | 110 | 0 |
EX328119 | 110 | 1 | 110 | 0 |
EX412595 | 110 | 1 | 110 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|