| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10425794g0020 |
| Family | GH1 |
| Protein Properties | Length: 95 Molecular Weight: 10778.1 Isoelectric Point: 8.7618 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 1 | 95 | 3.20057e-42 |
| VEGAAQEYEKGPSIWDTFSHIPGKIADGKNGDVAVDQYHRYKEDVQLLKYMGMDLYRFSISWSRIYPKGSPRHGGVNPKGIAYYNNLINELLKNG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 95 Download |
| VEGAAQEYEK GPSIWDTFSH IPGKIADGKN GDVAVDQYHR YKEDVQLLKY MGMDLYRFSI 60 SWSRIYPKGS PRHGGVNPKG IAYYNNLINE LLKNG |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02998 | PLN02998 | 2.0e-28 | 1 | 95 | 95 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 6.0e-29 | 2 | 95 | 94 | + beta-glucosidase | ||
| COG2723 | BglB | 5.0e-34 | 1 | 95 | 97 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam00232 | Glyco_hydro_1 | 8.0e-45 | 1 | 95 | 95 | + Glycosyl hydrolase family 1. | ||
| TIGR03356 | BGL | 4.0e-45 | 1 | 95 | 95 | + beta-galactosidase. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK24629.1 | 3e-38 | 1 | 95 | 30 | 121 | unknown [Picea sitchensis] |
| GenBank | ABK60303.2 | 1e-35 | 2 | 95 | 51 | 144 | glycosylhydrolase family 1 [Leucaena leucocephala] |
| RefSeq | NP_001142124.1 | 5e-36 | 1 | 95 | 55 | 146 | hypothetical protein LOC100274288 [Zea mays] |
| RefSeq | XP_002305150.1 | 3e-35 | 2 | 95 | 53 | 146 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002513440.1 | 3e-36 | 2 | 94 | 56 | 148 | beta-glucosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3scs_B | 2e-34 | 1 | 95 | 35 | 126 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3scs_A | 2e-34 | 1 | 95 | 35 | 126 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3scr_B | 2e-34 | 1 | 95 | 35 | 126 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| PDB | 3scr_A | 2e-34 | 1 | 95 | 35 | 126 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| PDB | 3scq_B | 2e-34 | 1 | 95 | 35 | 126 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CO477320 | 95 | 1 | 95 | 0 |
| GE477043 | 95 | 1 | 95 | 0 |
| GT245683 | 95 | 1 | 95 | 0 |
| EX423880 | 95 | 1 | 95 | 0 |
| CO483340 | 95 | 1 | 95 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |