Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10425967g0010 |
Family | GH19 |
Protein Properties | Length: 165 Molecular Weight: 17651.6 Isoelectric Point: 10.1839 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 66 | 165 | 0 |
GEYCQASSEWPCASGKRYYGRGPVQISWNYNYGPAGKAVGFDGINNPDIVANDATVSFKTAVWFWMTEQSPKPSCHNVMAGGWGPSGSDTAAGRAAGYGV |
Full Sequence |
---|
Protein Sequence Length: 165 Download |
MLSPVSAPPA ISLLRKESSL LFLAKPPMKP QVDGRRPPTA RTRGVIVSKR SKAILPXXXX 60 XXNPPGEYCQ ASSEWPCASG KRYYGRGPVQ ISWNYNYGPA GKAVGFDGIN NPDIVANDAT 120 VSFKTAVWFW MTEQSPKPSC HNVMAGGWGP SGSDTAAGRA AGYGV |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG3179 | COG3179 | 0.002 | 80 | 132 | 53 | + Predicted chitinase [General function prediction only] |
cd00442 | lysozyme_like | 4.0e-11 | 76 | 139 | 64 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. |
cd00325 | chitinase_glyco_hydro_19 | 5.0e-57 | 65 | 165 | 101 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
pfam00182 | Glyco_hydro_19 | 6.0e-59 | 63 | 165 | 103 | + Chitinase class I. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK21438.1 | 0 | 63 | 165 | 188 | 290 | unknown [Picea sitchensis] |
GenBank | ABK22517.1 | 0 | 63 | 165 | 142 | 244 | unknown [Picea sitchensis] |
GenBank | ABK24218.1 | 0 | 63 | 165 | 172 | 274 | unknown [Picea sitchensis] |
GenBank | ABK27143.1 | 0 | 63 | 165 | 142 | 244 | unknown [Picea sitchensis] |
GenBank | ACJ06635.1 | 0 | 63 | 165 | 49 | 151 | class II chitinase [Musa AB Group] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3iwr_B | 1.96182e-44 | 63 | 165 | 147 | 249 | A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase |
PDB | 3iwr_A | 1.96182e-44 | 63 | 165 | 147 | 249 | A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase |
PDB | 2dkv_A | 1.96182e-44 | 63 | 165 | 147 | 249 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
PDB | 4dyg_B | 1.96182e-44 | 67 | 165 | 96 | 194 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
PDB | 4dyg_A | 1.96182e-44 | 67 | 165 | 96 | 194 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DV979205 | 103 | 63 | 165 | 0 |
DV979205 | 56 | 1 | 56 | 0 |
DV984073 | 103 | 63 | 165 | 0 |
DV984073 | 56 | 1 | 56 | 0 |
GH287194 | 103 | 63 | 165 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |