| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10428207g0020 |
| Family | CE8 |
| Protein Properties | Length: 103 Molecular Weight: 11780.2 Isoelectric Point: 9.4618 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 1 | 81 | 1.1e-26 |
| MYLGRAWGRYSRVVFAYTYIANITFPEGWDNWRDPTRESTVFYGLYKCSGPGATNKGRVSWSRELSDVEAAPFLSSSFIDG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 103 Download |
| MYLGRAWGRY SRVVFAYTYI ANITFPEGWD NWRDPTREST VFYGLYKCSG PGATNKGRVS 60 WSRELSDVEA APFLSSSFID GESWITNMPS RLQRATNLIP RQG |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02671 | PLN02671 | 7.0e-29 | 1 | 85 | 85 | + pectinesterase | ||
| PLN02304 | PLN02304 | 1.0e-33 | 1 | 85 | 85 | + probable pectinesterase | ||
| PLN02665 | PLN02665 | 6.0e-34 | 2 | 90 | 89 | + pectinesterase family protein | ||
| PLN02432 | PLN02432 | 7.0e-38 | 2 | 85 | 84 | + putative pectinesterase | ||
| PLN02682 | PLN02682 | 3.0e-47 | 1 | 87 | 87 | + pectinesterase family protein | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI27989.1 | 4e-35 | 1 | 85 | 227 | 311 | unnamed protein product [Vitis vinifera] |
| GenBank | EEC79546.1 | 3e-35 | 1 | 85 | 312 | 396 | hypothetical protein OsI_20666 [Oryza sativa Indica Group] |
| RefSeq | NP_001056077.1 | 3e-35 | 1 | 85 | 312 | 396 | Os05g0521600 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_002330522.1 | 2e-35 | 1 | 85 | 295 | 379 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002514210.1 | 6e-38 | 1 | 85 | 297 | 381 | Pectinesterase PPE8B precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 0.000000000003 | 2 | 85 | 222 | 308 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.00000000002 | 2 | 85 | 218 | 304 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CO239716 | 103 | 1 | 103 | 0 |
| CO478344 | 103 | 1 | 103 | 0 |
| CA022603 | 85 | 1 | 85 | 1e-37 |
| FN743511 | 86 | 1 | 86 | 3e-37 |
| CA022678 | 85 | 1 | 85 | 4e-37 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |