Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10428980g0010 |
Family | GT35 |
Protein Properties | Length: 223 Molecular Weight: 25419.5 Isoelectric Point: 4.4677 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT35 | 63 | 220 | 0 |
ALKQLGFDMETLVEQEGDAALGNGGLARLSACLMDSLATLDLPAWGYGLRYQYGLFRQVIIDGFQREQPDYWLNFGNPWEIERAHITYPVKVEAVAYDNP IPGYGTGNTINLRLWAAKPSSESDLESFNTGDYINAIINKQRAETISSVLLPDDRSYQ |
Full Sequence |
---|
Protein Sequence Length: 223 Download |
MEVLQATAHS VRDRLIESWN DTHQYFREKD PKRLFFLSLE FLMGRSLSNS IYNLGIKDQY 60 AEALKQLGFD METLVEQEGD AALGNGGLAR LSACLMDSLA TLDLPAWGYG LRYQYGLFRQ 120 VIIDGFQREQ PDYWLNFGNP WEIERAHITY PVKVEAVAYD NPIPGYGTGN TINLRLWAAK 180 PSSESDLESF NTGDYINAII NKQRAETISS VLLPDDRSYQ VDF |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG0058 | GlgP | 2.0e-66 | 1 | 216 | 217 | + Glucan phosphorylase [Carbohydrate transport and metabolism] | ||
pfam00343 | Phosphorylase | 1.0e-74 | 63 | 220 | 178 | + Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin. | ||
PRK14986 | PRK14986 | 3.0e-75 | 2 | 219 | 237 | + glycogen phosphorylase; Provisional | ||
TIGR02093 | P_ylase | 3.0e-104 | 2 | 220 | 242 | + glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
cd04300 | GT1_Glycogen_Phosphorylase | 2.0e-127 | 2 | 220 | 242 | + This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI30609.1 | 0 | 2 | 220 | 35 | 276 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_001757919.1 | 0 | 1 | 220 | 34 | 276 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_002273615.1 | 0 | 2 | 220 | 39 | 280 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002305114.1 | 0 | 2 | 220 | 39 | 280 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002509431.1 | 0 | 5 | 220 | 206 | 444 | glycogen phosphorylase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1ygp_B | 0 | 1 | 220 | 66 | 323 | A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. |
PDB | 1ygp_A | 0 | 1 | 220 | 66 | 323 | A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. |
PDB | 2gj4_A | 0 | 6 | 220 | 43 | 276 | A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand |
PDB | 1abb_D | 0 | 6 | 220 | 45 | 278 | A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate |
PDB | 1abb_C | 0 | 6 | 220 | 45 | 278 | A Chain A, Control Of Phosphorylase B Conformation By A Modified Cofactor: Crystallographic Studies On R-State Glycogen Phosphorylase Reconstituted With Pyridoxal 5'-Diphosphate |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
HO779924 | 243 | 1 | 220 | 0 |
BQ870015 | 165 | 1 | 165 | 0 |
ES335482 | 195 | 49 | 220 | 0 |
GE483848 | 165 | 1 | 165 | 0 |
EL476666 | 241 | 2 | 218 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|