Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10429655g0010 |
Family | CBM43 |
Protein Properties | Length: 121 Molecular Weight: 13406.9 Isoelectric Point: 6.2022 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 32 | 115 | 9.2e-28 |
WCIAKPSAFDNDLLANINFACSQSGVDCSALQNGNPCYYPDTPVSHAAVAMNLYFQHYGRNYWNCYFNNTGIVALTDPSFGNCQ |
Full Sequence |
---|
Protein Sequence Length: 121 Download |
LCFFTSFPLF AAGARHARGL SSQKDNPGQR LWCIAKPSAF DNDLLANINF ACSQSGVDCS 60 ALQNGNPCYY PDTPVSHAAV AMNLYFQHYG RNYWNCYFNN TGIVALTDPS FGNCQYISQD 120 E |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-14 | 31 | 103 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-29 | 31 | 116 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG26564.1 | 6e-32 | 29 | 116 | 73 | 158 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
GenBank | ACG36169.1 | 2e-32 | 28 | 116 | 22 | 108 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
GenBank | ACG39487.1 | 3e-32 | 28 | 116 | 35 | 121 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
RefSeq | XP_002285661.1 | 9e-33 | 28 | 116 | 27 | 113 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002528491.1 | 4e-32 | 19 | 116 | 21 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 8e-26 | 32 | 118 | 13 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO204361 | 121 | 1 | 121 | 0 |
DR568306 | 121 | 1 | 121 | 0 |
DR561123 | 121 | 1 | 121 | 0 |
CO234599 | 121 | 1 | 121 | 0 |
CO212415 | 121 | 1 | 121 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|