| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10430283g0010 |
| Family | GH35 |
| Protein Properties | Length: 83 Molecular Weight: 9631.12 Isoelectric Point: 8.4588 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH35 | 1 | 70 | 1.8e-34 |
| MWPHLLSMSKESGADVIQTYTFWNGHEPVRGQYNFAGRYDLVKFVKLVQNAGLYLHLRIGPYVCAEWNFG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 83 Download |
| MWPHLLSMSK ESGADVIQTY TFWNGHEPVR GQYNFAGRYD LVKFVKLVQN AGLYLHLRIG 60 PYVCAEWNFG LSLHPSPLFL QYL |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02449 | Glyco_hydro_42 | 0.007 | 2 | 58 | 58 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. | ||
| COG1874 | LacA | 5.0e-6 | 1 | 67 | 69 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PLN03059 | PLN03059 | 5.0e-36 | 1 | 83 | 83 | + beta-galactosidase; Provisional | ||
| pfam01301 | Glyco_hydro_35 | 9.0e-38 | 1 | 70 | 70 | + Glycosyl hydrolases family 35. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAF31232.1 | 3e-33 | 1 | 70 | 61 | 130 | beta-D-galactosidase [Persea americana] |
| EMBL | CBI17270.1 | 8e-34 | 1 | 70 | 59 | 128 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_565755.1 | 3e-33 | 1 | 70 | 68 | 137 | BGAL9 (Beta galactosidase 9); beta-galactosidase/ catalytic/ cation binding / sugar binding [Arabidopsis thaliana] |
| RefSeq | XP_002263385.1 | 8e-34 | 1 | 70 | 59 | 128 | PREDICTED: similar to pear beta-galactosidase3 [Vitis vinifera] |
| RefSeq | XP_002530296.1 | 2e-33 | 1 | 83 | 55 | 133 | beta-galactosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3d3a_A | 2e-18 | 2 | 70 | 39 | 107 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_B | 0.000000000000004 | 2 | 70 | 34 | 102 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_A | 0.000000000000004 | 2 | 70 | 34 | 102 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8c_B | 0.000000000000004 | 2 | 70 | 34 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 0.000000000000004 | 2 | 70 | 34 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FG442740 | 70 | 1 | 70 | 1e-36 |
| BY815022 | 70 | 1 | 70 | 1e-36 |
| DR367884 | 70 | 1 | 70 | 2e-36 |
| ES431542 | 70 | 1 | 70 | 9e-36 |
| AV830892 | 70 | 1 | 70 | 1e-35 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |