| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10430442g0010 |
| Family | AA2 |
| Protein Properties | Length: 227 Molecular Weight: 24771.4 Isoelectric Point: 6.2598 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| AA2 | 50 | 149 | 1.2e-21 |
| TEIXGPTWAVELGRRDGLKSSNSDASSHLPSSQSNAQALIDSFSSNGLSIRDLVTLSGAHTFGKSHCPTVARRLYQFSNNNGIDPTLNKTYAMGLMKKCT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 227 Download |
| QNEGIFSSDS ALVIDARTRV FVTEYANDEN SFRDQFGDAM IRMGRIQILT EIXGPTWAVE 60 LGRRDGLKSS NSDASSHLPS SQSNAQALID SFSSNGLSIR DLVTLSGAHT FGKSHCPTVA 120 RRLYQFSNNN GIDPTLNKTY AMGLMKKCTL PINPNATVPL DPSTPNTFDN AYFQELLQNE 180 GIFSSDSALF GDAMIRMGRI QILTGQQGEI RKRCGFVNSN STGQAAN |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00693 | secretory_peroxidase | 1.0e-14 | 1 | 54 | 54 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| pfam00141 | peroxidase | 5.0e-17 | 54 | 110 | 57 | + Peroxidase. | ||
| PLN03030 | PLN03030 | 3.0e-28 | 54 | 218 | 193 | + cationic peroxidase; Provisional | ||
| cd00693 | secretory_peroxidase | 2.0e-74 | 54 | 217 | 187 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_001751508.1 | 0.0002 | 1 | 48 | 279 | 326 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001751508.1 | 0 | 54 | 218 | 155 | 342 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001783974.1 | 0.00003 | 1 | 48 | 251 | 298 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001783974.1 | 0 | 49 | 218 | 122 | 314 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_002268127.1 | 1.4013e-45 | 54 | 218 | 139 | 326 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3hdl_A | 8e-37 | 56 | 219 | 116 | 304 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 3hdl_A | 0.003 | 4 | 54 | 243 | 293 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1gx2_B | 5e-36 | 40 | 221 | 101 | 309 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
| PDB | 1gx2_A | 5e-36 | 40 | 221 | 101 | 309 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
| PDB | 3atj_B | 9e-36 | 40 | 221 | 101 | 309 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CO239331 | 213 | 38 | 227 | 0 |
| DR579138 | 197 | 54 | 227 | 0 |
| DR572547 | 213 | 38 | 227 | 0 |
| CO239331 | 72 | 1 | 72 | 6e-25 |
| DR579138 | 72 | 1 | 72 | 7e-25 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_9930140g0010 | MA_591890g0010 | |||
| Vitis vinifera | GSVIVT01017829001 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |