Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10433598g0020 |
Family | AA2 |
Protein Properties | Length: 101 Molecular Weight: 10681.1 Isoelectric Point: 4.3265 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 2 | 86 | 5.6e-24 |
GCDASILLDSTATNLAKTEVVANRFLGGLDIIDDAKASLEADCPGVVSCADILALATRDAVVMLEAGPSWTMRTGRRDFAQPSTQ |
Full Sequence |
---|
Protein Sequence Length: 101 Download |
MGCDASILLD STATNLAKTE VVANRFLGGL DIIDDAKASL EADCPGVVSC ADILALATRD 60 AVVMLEAGPS WTMRTGRRDF AQPSTQSTRN AINNRVLLDN V |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03030 | PLN03030 | 1.0e-24 | 2 | 79 | 78 | + cationic peroxidase; Provisional | ||
pfam00141 | peroxidase | 1.0e-24 | 2 | 85 | 85 | + Peroxidase. | ||
cd00693 | secretory_peroxidase | 2.0e-36 | 2 | 94 | 93 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABQ23446.1 | 7e-22 | 2 | 79 | 72 | 149 | putative peroxidase [Cinnamomum micranthum f. kanehirae] |
EMBL | CAH69359.1 | 7e-22 | 2 | 88 | 72 | 157 | TPA: class III peroxidase 117 precursor [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001060836.1 | 7e-22 | 2 | 88 | 73 | 158 | Os08g0113000 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002516847.1 | 4e-22 | 2 | 79 | 73 | 150 | conserved hypothetical protein [Ricinus communis] |
RefSeq | XP_002527239.1 | 3e-22 | 2 | 79 | 75 | 151 | Peroxidase 27 precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4a5g_B | 2e-17 | 1 | 79 | 49 | 127 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 4a5g_A | 2e-17 | 1 | 79 | 49 | 127 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 1qo4_A | 6e-17 | 2 | 79 | 49 | 126 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 1pa2_A | 6e-17 | 2 | 79 | 49 | 126 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
PDB | 1sch_B | 9e-17 | 1 | 79 | 47 | 125 | A Chain A, Peanut Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CF671003 | 78 | 2 | 79 | 4e-33 |
DV142551 | 93 | 2 | 94 | 8e-24 |
BP955146 | 78 | 2 | 79 | 1e-23 |
FG346918 | 95 | 2 | 96 | 1e-22 |
GW832560 | 78 | 2 | 79 | 1e-22 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|