Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10434775g0010 |
Family | PL4 |
Protein Properties | Length: 220 Molecular Weight: 24597.3 Isoelectric Point: 4.3319 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
PL4 | 1 | 212 | 0 |
MFHSAHYAGEDLVPKFRDGEPWQKVFGPVFIYVNSIMDGVEGQPSMLWEDAKKQMIIEVESWPYNFPASSNFPKSEDRGSVSGTLLVKDNVGEEDVTPAD SAYVGLALPGENGSWQRESKGYQFWTRTDINGSFTINNIRGGDYNLYAWVPGVIGDYKNEDIITVSAGSNINLGALTYEAPRDGPTMWEIGVPSRTAAEF YVPDPNPKYINR |
Full Sequence |
---|
Protein Sequence Length: 220 Download |
MFHSAHYAGE DLVPKFRDGE PWQKVFGPVF IYVNSIMDGV EGQPSMLWED AKKQMIIEVE 60 SWPYNFPASS NFPKSEDRGS VSGTLLVKDN VGEEDVTPAD SAYVGLALPG ENGSWQRESK 120 GYQFWTRTDI NGSFTINNIR GGDYNLYAWV PGVIGDYKNE DIITVSAGSN INLGALTYEA 180 PRDGPTMWEI GVPSRTAAEF YVPDPNPKYI NRLYIDHPDK |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam13620 | CarboxypepD_reg | 0.002 | 80 | 173 | 96 | + Carboxypeptidase regulatory-like domain. | ||
cd10320 | RGL4_N | 3.0e-6 | 1 | 35 | 35 | + N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11. | ||
cd10317 | RGL4_C | 5.0e-7 | 188 | 220 | 33 | + C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11. | ||
cd10316 | RGL4_M | 2.0e-34 | 77 | 176 | 100 | + Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAD33013.1 | 0 | 1 | 220 | 1 | 218 | MYST1-like protein [Oryza sativa Japonica Group] |
RefSeq | XP_002285626.1 | 0 | 1 | 220 | 241 | 458 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002285627.1 | 0 | 1 | 220 | 123 | 340 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002301112.1 | 0 | 1 | 220 | 241 | 458 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002301115.1 | 0 | 1 | 220 | 351 | 569 | predicted protein [Populus trichocarpa] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX392917 | 205 | 1 | 205 | 0 |
GT822654 | 211 | 10 | 220 | 0 |
DV139551 | 220 | 1 | 220 | 0 |
DV151305 | 220 | 1 | 220 | 0 |
JK499576 | 207 | 1 | 207 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|