CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_10435904g0010
FamilyGH81
Protein PropertiesLength: 300 Molecular Weight: 33634.9 Isoelectric Point: 5.7049
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH8122950
  FLERSITPWLTGTLRGNGLAFDGKWGGIISRDGSNDSTADFGLGLYNDHHFHFGYFCYASAVLAKLNGDWGRRFKPQIYSIVNDFLTGYNGRRALYTRLR
  NFDLWTLHSWASGLTEFPDGRNQESTSEALNAYYSAALLGLAYGDQRLISTGSALAALEIRSAKALXXXXALEIRSAKALWHVPSNSTLYEAEFVTENRV
  VGILWANKRDSKLWFAGPECRECRLGIQLLPLLPITELLFSDLEYARELVDWTSESRDGDIADGWKGFLLALEGVYDTAAALRKVQALTSYDNY
Full Sequence
Protein Sequence     Length: 300     Download
EFLERSITPW LTGTLRGNGL AFDGKWGGII SRDGSNDSTA DFGLGLYNDH HFHFGYFCYA    60
SAVLAKLNGD WGRRFKPQIY SIVNDFLTGY NGRRALYTRL RNFDLWTLHS WASGLTEFPD    120
GRNQESTSEA LNAYYSAALL GLAYGDQRLI STGSALAALE IRSAKALXXX XALEIRSAKA    180
LWHVPSNSTL YEAEFVTENR VVGILWANKR DSKLWFAGPE CRECRLGIQL LPLLPITELL    240
FSDLEYAREL VDWTSESRDG DIADGWKGFL LALEGVYDTA AALRKVQALT SYDNYRALVL    300
                                                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF23.0e-2920221205+
pfam03639Glyco_hydro_815.0e-702294294+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69784.101299371656beta-glucan-binding protein 4 [Medicago truncatula]
GenBankEAZ08905.102299348632hypothetical protein OsI_31170 [Oryza sativa Indica Group]
GenBankEEE69610.102298379662hypothetical protein OsJ_29181 [Oryza sativa Japonica Group]
RefSeqNP_001063051.102298378661Os09g0379900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002282971.101299427714PREDICTED: hypothetical protein [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR577637233622940
GT23920824412430
GH28404625712570
CO484747271302980
GT239550217842990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)