| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10437110g0010 |
| Family | GH17 |
| Protein Properties | Length: 124 Molecular Weight: 13769 Isoelectric Point: 5.6211 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 25 | 95 | 5.2e-21 |
| LGVNWGIVALHPLSPDIVVEMLKDNGIKKVKLFDADGDTLRALANTDIEVMVAIPNNMFQRLSDSYKVAEK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 124 Download |
| MMERTWFVGL IIFVLRSMAC AVERLGVNWG IVALHPLSPD IVVEMLKDNG IKKVKLFDAD 60 GDTLRALANT DIEVMVAIPN NMFQRLSDSY KVAEKYFSGG VNINSYTILQ PTHDDIEVGG 120 KHGS |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-10 | 25 | 89 | 65 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABN09816.1 | 1e-23 | 2 | 103 | 1 | 112 | Glycoside hydrolase, family 17; X8 [Medicago truncatula] |
| RefSeq | NP_001050810.1 | 6e-23 | 21 | 103 | 23 | 113 | Os03g0656800 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001051526.1 | 6e-23 | 21 | 103 | 30 | 120 | Os03g0792800 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_201284.1 | 5e-23 | 8 | 96 | 11 | 99 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002277003.1 | 8e-23 | 1 | 103 | 1 | 111 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.00001 | 25 | 93 | 1 | 69 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghr_A | 0.00001 | 25 | 86 | 1 | 62 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1aq0_B | 0.00001 | 25 | 86 | 1 | 62 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1aq0_A | 0.00001 | 25 | 86 | 1 | 62 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1ghs_B | 0.003 | 25 | 89 | 1 | 65 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 0 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DV997931 | 111 | 2 | 103 | 0 |
| GE474134 | 111 | 2 | 103 | 0 |
| EX343127 | 111 | 2 | 103 | 0 |
| CO474008 | 95 | 2 | 96 | 0 |
| DR686407 | 112 | 1 | 103 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |