| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_1055674g0010 |
| Family | GH17 |
| Protein Properties | Length: 104 Molecular Weight: 11550.4 Isoelectric Point: 7.5126 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 9 | 98 | 2.8e-27 |
| GVNWGTVALHPLSPDIVVEMLKDNGIKKVKLFDANGDTLRALADTDIEVMVAIPNNMLQHLSDSYKVVEKWVGKNVTRYNFSGGVNIKYV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 104 Download |
| MACGVERMGV NWGTVALHPL SPDIVVEMLK DNGIKKVKLF DANGDTLRAL ADTDIEVMVA 60 IPNNMLQHLS DSYKVVEKWV GKNVTRYNFS GGVNIKYVES MVPR |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-14 | 9 | 98 | 90 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABN09816.1 | 3e-33 | 3 | 98 | 21 | 115 | Glycoside hydrolase, family 17; X8 [Medicago truncatula] |
| RefSeq | NP_001050810.1 | 4e-32 | 6 | 98 | 25 | 116 | Os03g0656800 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001051526.1 | 4e-33 | 6 | 98 | 32 | 123 | Os03g0792800 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_001773368.1 | 9e-32 | 5 | 98 | 24 | 117 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_002463758.1 | 4e-32 | 6 | 98 | 29 | 120 | hypothetical protein SORBIDRAFT_01g005610 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1ghr_A | 0.000000009 | 8 | 87 | 1 | 80 | A Chain A, Crystal Structure Of A Putative Dehydrogenase (Rpa1076) From Rhodopseudomonas Palustris Cga009 At 2.57 A Resolution |
| PDB | 1aq0_B | 0.000000009 | 8 | 87 | 1 | 80 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1aq0_A | 0.000000009 | 8 | 87 | 1 | 80 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 2cyg_A | 0.00000002 | 8 | 87 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghs_B | 0.000002 | 8 | 100 | 1 | 91 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DV997931 | 98 | 1 | 98 | 0 |
| GE474134 | 98 | 1 | 98 | 0 |
| EX343127 | 98 | 1 | 98 | 0 |
| CT575935 | 98 | 1 | 98 | 0 |
| BQ291086 | 98 | 1 | 98 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |