| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_111103g0020 |
| Family | GH32 |
| Protein Properties | Length: 143 Molecular Weight: 16085.5 Isoelectric Point: 9.2198 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH32 | 56 | 134 | 1.3e-30 |
| HFQPVKHWMNAPLFYKGYYHLFYQYNPKSAVWGRIMWGHAVSRDLINWVHMAGAAIYPDEGYDANGTWSGSATFLHKGG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 143 Download |
| MAMGKSYSLL CPFFFLLLIH VLQASHHEWD EATLSALKAS KSSSMAPSEA YRTAYHFQPV 60 KHWMNAPLFY KGYYHLFYQY NPKSAVWGRI MWGHAVSRDL INWVHMAGAA IYPDEGYDAN 120 GTWSGSATFL HKGGAPVIKG ALP 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01322 | scrB_fam | 4.0e-23 | 46 | 127 | 85 | + sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| COG1621 | SacC | 1.0e-28 | 51 | 127 | 80 | + Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism] | ||
| cd08996 | GH32_B_Fructosidase | 5.0e-29 | 62 | 138 | 80 | + Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. | ||
| pfam00251 | Glyco_hydro_32N | 3.0e-37 | 56 | 131 | 79 | + Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure. | ||
| smart00640 | Glyco_32 | 2.0e-37 | 56 | 131 | 79 | + Glycosyl hydrolases family 32. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAA63802.1 | 4e-33 | 14 | 138 | 8 | 135 | invertase [Arabidopsis thaliana] |
| EMBL | CAB43403.1 | 4e-34 | 14 | 138 | 8 | 132 | beta-fructofuranosidase [Arabidopsis thaliana] |
| EMBL | CAB85898.1 | 1e-33 | 4 | 138 | 12 | 140 | beta-fructosidase [Solanum pennellii] |
| RefSeq | NP_190828.2 | 4e-33 | 14 | 138 | 8 | 135 | AtcwINV2 (Arabidopsis thaliana cell wall invertase 2); hydrolase, hydrolyzing O-glycosyl compounds |
| RefSeq | XP_002510944.1 | 4e-33 | 52 | 133 | 117 | 197 | Beta-fructofuranosidase, soluble isoenzyme I precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2qqw_A | 2e-28 | 48 | 138 | 1 | 92 | A Chain A, Crystal Structure Of A Cell-Wall Invertase (D23a) From Arabidopsis Thaliana In Complex With Sucrose |
| PDB | 2ac1_A | 5e-28 | 48 | 138 | 5 | 96 | A Chain A, Crystal Structure Of A Cell-Wall Invertase From Arabidopsis Thaliana |
| PDB | 2qqv_A | 5e-28 | 48 | 138 | 1 | 92 | A Chain A, Crystal Structure Of A Cell-Wall Invertase (E203a) From Arabidopsis Thaliana In Complex With Sucrose |
| PDB | 2oxb_A | 5e-28 | 48 | 138 | 1 | 92 | A Chain A, Crystal Structure Of A Cell-Wall Invertase (E203q) From Arabidopsis Thaliana In Complex With Sucrose |
| PDB | 2qqu_A | 5e-28 | 48 | 138 | 1 | 92 | A Chain A, Crystal Structure Of A Cell-Wall Invertase (D239a) From Arabidopsis Thaliana In Complex With Sucrose |
