Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_158860g0090 |
Family | GT2 |
Protein Properties | Length: 329 Molecular Weight: 35983.5 Isoelectric Point: 10.4696 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT2 | 16 | 176 | 2.5e-27 |
SIVVPVRNEQDNVAPLIAEIAAALDGRWAYEIIYVNDGSTDATGERLAAEMKARGNVRQIRHAASSGQSAAVRTGVRAARGKIVATLDGDGQNNPAFLPA LIEAIEKGGDKVGLAAGQRVGRKDTGFKRFQSRAANGVRNAILHDGTRDTGCGLKALRRDV |
Full Sequence |
---|
Protein Sequence Length: 329 Download |
MNDQSSIPGL PAPDVSIVVP VRNEQDNVAP LIAEIAAALD GRWAYEIIYV NDGSTDATGE 60 RLAAEMKARG NVRQIRHAAS SGQSAAVRTG VRAARGKIVA TLDGDGQNNP AFLPALIEAI 120 EKGGDKVGLA AGQRVGRKDT GFKRFQSRAA NGVRNAILHD GTRDTGCGLK ALRRDVFLAL 180 PYFDGLHRFL PALVRREGYD IVYVDVIDRP RHSGVSNYGF FDRLWIGIMD LAGVWWLIRR 240 KKSTPVATEL LFTARFLVQW ISSERAGQSV VPMAFWFFSM GGGFMTLIYG IAKREPVIIL 300 GQGLATIIYI RNIMLILKNR GSGSKVEKS |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd06442 | DPM1_like | 3.0e-22 | 17 | 237 | 232 | + DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
pfam07578 | LAB_N | 1.0e-22 | 250 | 313 | 64 | + Lipid A Biosynthesis N-terminal domain. This family is found at the N-terminus of a group of Chlamydial Lipid A biosynthesis proteins. It is also found by itself in a family of proteins of unknown function. | ||
COG3952 | COG3952 | 2.0e-24 | 250 | 322 | 73 | + Predicted membrane protein [Function unknown] | ||
cd04179 | DPM_DPG-synthase_like | 2.0e-38 | 17 | 193 | 181 | + DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
cd04187 | DPM1_like_bac | 9.0e-39 | 17 | 199 | 184 | + Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_947899.1 | 0 | 11 | 250 | 10 | 249 | glycosyl transferase family protein [Rhodopseudomonas palustris CGA009] |
RefSeq | YP_001991811.1 | 0 | 11 | 250 | 10 | 249 | glycosyl transferase family 2 [Rhodopseudomonas palustris TIE-1] |
RefSeq | YP_318145.1 | 0 | 12 | 251 | 7 | 246 | glycosyl transferase family protein [Nitrobacter winogradskyi Nb-255] |
RefSeq | YP_577332.1 | 0 | 1 | 251 | 1 | 250 | glycosyl transferase family protein [Nitrobacter hamburgensis X14] |
RefSeq | ZP_01047193.1 | 0 | 12 | 251 | 7 | 246 | glycosyl transferase, family 2 [Nitrobacter sp. Nb-311A] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2z87_B | 0.000007 | 15 | 120 | 94 | 198 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp- Galnac And Udp |
PDB | 2z87_A | 0.000007 | 15 | 120 | 94 | 198 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp- Galnac And Udp |
PDB | 2z86_D | 0.000007 | 15 | 120 | 95 | 199 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |