Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_159008g0220 |
Family | AA6 |
Protein Properties | Length: 199 Molecular Weight: 20682.4 Isoelectric Point: 7.8528 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 3 | 196 | 0 |
KVLVLYYSAYGHIEAMANAVAEGAREAGATVDIKRVPELVPPDVAKASYYKVDQAAPVAKIEDLANYDAIIVGTGTRFGRISSQMANFLDQAGGLWAKGA LHGKVGGAFSSSATQHGGQETTLFSIITNLLHFGMVVVGLNYGFAGQMGVKEVTGGSPYGATTITDGDGSRQPSANELAGARYQGKTIAETAKK |
Full Sequence |
---|
Protein Sequence Length: 199 Download |
MAKVLVLYYS AYGHIEAMAN AVAEGAREAG ATVDIKRVPE LVPPDVAKAS YYKVDQAAPV 60 AKIEDLANYD AIIVGTGTRF GRISSQMANF LDQAGGLWAK GALHGKVGGA FSSSATQHGG 120 QETTLFSIIT NLLHFGMVVV GLNYGFAGQM GVKEVTGGSP YGATTITDGD GSRQPSANEL 180 AGARYQGKTI AETAKKLHG |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK05569 | PRK05569 | 4.0e-11 | 1 | 49 | 49 | + flavodoxin; Provisional | ||
pfam03358 | FMN_red | 3.0e-16 | 3 | 141 | 141 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 7.0e-56 | 1 | 199 | 207 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 2.0e-94 | 2 | 197 | 197 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 5.0e-135 | 1 | 199 | 200 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_774208.1 | 0 | 1 | 199 | 1 | 199 | TrpR binding protein WrbA [Bradyrhizobium japonicum USDA 110] |
RefSeq | YP_001208007.1 | 0 | 1 | 199 | 1 | 199 | TrpR binding protein WrbA [Bradyrhizobium sp. ORS278] |
RefSeq | YP_002288077.1 | 0 | 1 | 199 | 1 | 199 | NAD(P)H:quinone oxidoreductase, type IV [Oligotropha carboxidovorans OM5] |
RefSeq | YP_488100.1 | 0 | 1 | 199 | 1 | 199 | TrpR binding protein WrbA [Rhodopseudomonas palustris HaA2] |
RefSeq | YP_571470.1 | 0 | 1 | 199 | 1 | 199 | TrpR binding protein WrbA [Rhodopseudomonas palustris BisB5] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 0 | 1 | 199 | 1 | 198 | A Chain A, The Crystal Structure Of The PsiHYBRID DOMAIN I-Egf1 Segment From The Human Integrin Beta2 At 1.8 Resolution |
PDB | 3b6m_A | 0 | 1 | 199 | 1 | 198 | A Chain A, The Crystal Structure Of The PsiHYBRID DOMAIN I-Egf1 Segment From The Human Integrin Beta2 At 1.8 Resolution |
PDB | 3b6k_B | 0 | 1 | 199 | 1 | 198 | A Chain A, The Crystal Structure Of The PsiHYBRID DOMAIN I-Egf1 Segment From The Human Integrin Beta2 At 1.8 Resolution |
PDB | 3b6k_A | 0 | 1 | 199 | 1 | 198 | A Chain A, The Crystal Structure Of The PsiHYBRID DOMAIN I-Egf1 Segment From The Human Integrin Beta2 At 1.8 Resolution |
PDB | 3b6j_B | 0 | 1 | 199 | 1 | 198 | A Chain A, The Crystal Structure Of The PsiHYBRID DOMAIN I-Egf1 Segment From The Human Integrin Beta2 At 1.8 Resolution |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
ES234548 | 201 | 1 | 197 | 0 |
ES235539 | 201 | 1 | 197 | 0 |
ES229367 | 201 | 1 | 197 | 0 |
EC657674 | 182 | 20 | 197 | 0 |
EG943791 | 180 | 22 | 197 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|