| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_168609g0010 |
| Family | GH35 |
| Protein Properties | Length: 148 Molecular Weight: 16997.9 Isoelectric Point: 8.2236 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH35 | 38 | 130 | 4.2039e-45 |
| LIIDGQRKLLMSASIHYPRSVPAMWPDLIAKAKEGGIDVIETYVFWNGHEPKEGTYYFEDRFDLVKFVKIAQQAGLYVNLRIGPFIAAEWIFG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 148 Download |
| MAATHPALLL FLCAITICTM ANLKWVSAVN VTYDHRSLII DGQRKLLMSA SIHYPRSVPA 60 MWPDLIAKAK EGGIDVIETY VFWNGHEPKE GTYYFEDRFD LVKFVKIAQQ AGLYVNLRIG 120 PFIAAEWIFG FVFLSFGPMH YFSHLRYF |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02449 | Glyco_hydro_42 | 2.0e-5 | 53 | 118 | 67 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. | ||
| COG1874 | LacA | 2.0e-18 | 31 | 130 | 102 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam01301 | Glyco_hydro_35 | 1.0e-51 | 37 | 130 | 94 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 6.0e-57 | 25 | 138 | 118 | + beta-galactosidase; Provisional | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK24373.1 | 0 | 24 | 130 | 24 | 130 | unknown [Picea sitchensis] |
| GenBank | ABN08770.1 | 0 | 9 | 130 | 14 | 127 | Galactose-binding like [Medicago truncatula] |
| GenBank | ACF22882.1 | 0 | 8 | 130 | 14 | 124 | beta-galactosidase [Glycine max] |
| EMBL | CAA06309.1 | 0 | 30 | 130 | 30 | 130 | beta-galactosidase [Cicer arietinum] |
| EMBL | CAA09457.1 | 0 | 25 | 130 | 17 | 124 | beta-galactosidase [Cicer arietinum] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4e8d_B | 3e-19 | 40 | 130 | 12 | 102 | A Chain A, The Structure Of Soybean Peroxidase |
| PDB | 4e8d_A | 3e-19 | 40 | 130 | 12 | 102 | A Chain A, The Structure Of Soybean Peroxidase |
| PDB | 4e8c_B | 3e-19 | 40 | 130 | 12 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 3e-19 | 40 | 130 | 12 | 102 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 3thd_D | 2e-18 | 31 | 130 | 11 | 110 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 7 | 29 | |||
| 123 | 145 | |||
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 0 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EX437765 | 136 | 1 | 136 | 0 |
| BY878504 | 124 | 7 | 130 | 0 |
| BY879452 | 139 | 7 | 143 | 0 |
| BY888414 | 124 | 7 | 130 | 0 |
| BY882019 | 124 | 7 | 130 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |