| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_17339g0010 |
| Family | GH17 |
| Protein Properties | Length: 139 Molecular Weight: 15176.5 Isoelectric Point: 5.036 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 20 | 109 | 5.2e-28 |
| LGVNWGTLSTHPLPPEIVVGMLKDNGINKVKLFDAEEHAMKALANSGIQVMVGIPNDQLQKMASSKKAAANWVEANATEFSLDGGVDIRY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 139 Download |
| MACLFSVLVM SVWVGWVQGL GVNWGTLSTH PLPPEIVVGM LKDNGINKVK LFDAEEHAMK 60 ALANSGIQVM VGIPNDQLQK MASSKKAAAN WVEANATEFS LDGGVDIRYA QFFFSFSFLS 120 NFAALVWYSV ESLGVDSNR |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-15 | 20 | 109 | 90 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK25447.1 | 4e-38 | 26 | 109 | 26 | 109 | unknown [Picea sitchensis] |
| GenBank | ABN09816.1 | 2e-32 | 2 | 109 | 8 | 114 | Glycoside hydrolase, family 17; X8 [Medicago truncatula] |
| RefSeq | XP_002277003.1 | 1e-29 | 17 | 109 | 22 | 113 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002324127.1 | 9e-33 | 17 | 109 | 38 | 130 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002330836.1 | 7e-32 | 9 | 109 | 27 | 127 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000000002 | 20 | 99 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghs_B | 0.000000004 | 20 | 109 | 1 | 88 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghs_A | 0.000000004 | 20 | 109 | 1 | 88 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghr_A | 0.00000003 | 20 | 109 | 1 | 87 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1aq0_B | 0.00000003 | 20 | 109 | 1 | 87 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 0 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CO477361 | 130 | 4 | 133 | 0 |
| GT236424 | 133 | 1 | 133 | 0 |
| CF389477 | 133 | 1 | 133 | 0 |
| GT248959 | 133 | 1 | 133 | 0 |
| DR058292 | 130 | 4 | 133 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |