Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_208144g0010 |
Family | GH3 |
Protein Properties | Length: 112 Molecular Weight: 12648.2 Isoelectric Point: 9.5181 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH3 | 2 | 95 | 4.2e-24 |
QAIGIEARAIYNAGQASRLIFWAPNINIFRDPRWGRGQETPGEDPLLSSRYSVAYVRGLQGDPLSSSSKEKFRSSIRLRASASCKHFTTYDMDN |
Full Sequence |
---|
Protein Sequence Length: 112 Download |
VQAIGIEARA IYNAGQASRL IFWAPNINIF RDPRWGRGQE TPGEDPLLSS RYSVAYVRGL 60 QGDPLSSSSK EKFRSSIRLR ASASCKHFTT YDMDNGEGHT RFSFDAMVIF HY 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG1472 | BglX | 3.0e-10 | 2 | 63 | 64 | + Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] | ||
PRK15098 | PRK15098 | 4.0e-12 | 2 | 91 | 91 | + beta-D-glucoside glucohydrolase; Provisional | ||
pfam00933 | Glyco_hydro_3 | 3.0e-16 | 2 | 106 | 105 | + Glycosyl hydrolase family 3 N terminal domain. | ||
PLN03080 | PLN03080 | 1.0e-41 | 2 | 108 | 107 | + Probable beta-xylosidase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002285805.1 | 5e-39 | 2 | 111 | 134 | 238 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002302284.1 | 1e-38 | 2 | 106 | 140 | 239 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002302285.1 | 4e-39 | 2 | 111 | 133 | 237 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002306583.1 | 1e-39 | 2 | 108 | 133 | 234 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002513892.1 | 1e-39 | 2 | 111 | 134 | 238 | Periplasmic beta-glucosidase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3u4a_B | 0.00000006 | 23 | 91 | 128 | 186 | A Chain A, Crystal Structure Of Protein Ef0006 From Enterococcus Faecalis |
PDB | 3u4a_A | 0.00000006 | 23 | 91 | 128 | 186 | A Chain A, Crystal Structure Of Protein Ef0006 From Enterococcus Faecalis |
PDB | 3u48_B | 0.00000006 | 23 | 91 | 128 | 186 | A Chain A, Crystal Structure Of Protein Ef0006 From Enterococcus Faecalis |
PDB | 3u48_A | 0.00000006 | 23 | 91 | 128 | 186 | A Chain A, Crystal Structure Of Protein Ef0006 From Enterococcus Faecalis |
PDB | 3ut0_D | 0.000002 | 24 | 105 | 160 | 228 | A Chain A, Crystal Structure Of Protein Ef0006 From Enterococcus Faecalis |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR565163 | 104 | 6 | 109 | 0 |
CO213876 | 112 | 1 | 112 | 0 |
JG634556 | 107 | 2 | 108 | 5.04467e-44 |
JG634956 | 107 | 2 | 108 | 5.04467e-44 |
JG630971 | 105 | 2 | 106 | 9.94922e-44 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|