Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_2210771g0010 |
Family | GH3 |
Protein Properties | Length: 97 Molecular Weight: 10907.6 Isoelectric Point: 9.2175 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH3 | 13 | 88 | 5e-25 |
SGLTFWAPNINIFRDPRWGRGQETPGEDPLLSSRYSVAYVRGLQGDPLSSSSKRNSSTRLRASACCKHFTAYDMDN |
Full Sequence |
---|
Protein Sequence Length: 97 Download |
IEARAIYNAG QASGLTFWAP NINIFRDPRW GRGQETPGED PLLSSRYSVA YVRGLQGDPL 60 SSSSKRNSST RLRASACCKH FTAYDMDNWE GHTRFXX |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG1472 | BglX | 7.0e-12 | 12 | 84 | 75 | + Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] | ||
PRK15098 | PRK15098 | 7.0e-12 | 18 | 84 | 67 | + beta-D-glucoside glucohydrolase; Provisional | ||
pfam00933 | Glyco_hydro_3 | 1.0e-17 | 6 | 93 | 97 | + Glycosyl hydrolase family 3 N terminal domain. | ||
PLN03080 | PLN03080 | 3.0e-45 | 1 | 95 | 95 | + Probable beta-xylosidase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_177929.1 | 9.99967e-42 | 2 | 95 | 134 | 225 | glycosyl hydrolase family 3 protein [Arabidopsis thaliana] |
RefSeq | XP_002302284.1 | 2e-40 | 2 | 95 | 145 | 235 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002306583.1 | 4.99997e-41 | 2 | 95 | 138 | 228 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002513887.1 | 5.99994e-41 | 2 | 95 | 146 | 236 | hypothetical protein RCOM_1034150 [Ricinus communis] |
RefSeq | XP_002513892.1 | 9.99967e-42 | 2 | 95 | 139 | 229 | Periplasmic beta-glucosidase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3u48_B | 0.000000001 | 3 | 84 | 112 | 186 | A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine |
PDB | 3u48_A | 0.000000001 | 3 | 84 | 112 | 186 | A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine |
PDB | 3u4a_B | 0.000000001 | 3 | 84 | 112 | 186 | A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine |
PDB | 3u4a_A | 0.000000001 | 3 | 84 | 112 | 186 | A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine |
PDB | 3ut0_D | 0.000004 | 12 | 58 | 152 | 199 | A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR565163 | 97 | 1 | 95 | 0 |
CO213876 | 97 | 1 | 95 | 1.4013e-45 |
JG611239 | 95 | 1 | 95 | 2.99878e-43 |
JG630971 | 96 | 1 | 95 | 2.99878e-43 |
JG634556 | 96 | 1 | 95 | 2.99878e-43 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|