| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_22175g0010 |
| Family | AA2 |
| Protein Properties | Length: 131 Molecular Weight: 15321.3 Isoelectric Point: 6.8059 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 4 | 122 | 2e-26 |
| PREGRLPDAEKGTQHLRDVFYRMGLSEKDIVALSGGNTLGRAHPERSRFDAAWTEQPLKFDNSYFLELLKGESEGLLQLPTYKFLLEDPNFHSYMELYIK NEYAFFKHYAKSHKKLFEL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 131 Download |
| MVSPREGRLP DAEKGTQHLR DVFYRMGLSE KDIVALSGGN TLGRAHPERS RFDAAWTEQP 60 LKFDNSYFLE LLKGESEGLL QLPTYKFLLE DPNFHSYMEL YIKNEYAFFK HYAKSHKKLF 120 ELKEGESQHS F |
| Functional Domains Download unfiltered results here | ||||||
|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
| pfam00141 | peroxidase | 6.0e-10 | 6 | 41 | 36 | + Peroxidase. |
| PLN02364 | PLN02364 | 2.0e-34 | 4 | 122 | 120 | + L-ascorbate peroxidase 1 |
| PLN02879 | PLN02879 | 2.0e-37 | 4 | 122 | 119 | + L-ascorbate peroxidase |
| cd00691 | ascorbate_peroxidase | 6.0e-56 | 4 | 122 | 123 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
| PLN02608 | PLN02608 | 1.0e-61 | 1 | 122 | 122 | + L-ascorbate peroxidase |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK21917.1 | 0 | 1 | 122 | 122 | 243 | unknown [Picea sitchensis] |
| GenBank | ABK22483.1 | 0 | 1 | 122 | 122 | 243 | unknown [Picea sitchensis] |
| DDBJ | BAB64351.1 | 0 | 2 | 122 | 122 | 242 | peroxisomal ascorbate peroxidase [Cucurbita cv. Kurokawa Amakuri] |
| GenBank | EAZ10942.1 | 0 | 2 | 122 | 72 | 192 | hypothetical protein OsJ_00785 [Oryza sativa Japonica Group] |
| RefSeq | NP_001062439.1 | 0 | 2 | 122 | 122 | 242 | Os08g0549100 [Oryza sativa (japonica cultivar-group)] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3zcy_A | 8.40779e-45 | 4 | 122 | 125 | 244 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
| PDB | 2y6a_A | 8.40779e-45 | 4 | 122 | 125 | 244 | A Chain A, Ascorbate Peroxidase R38a Mutant |
| PDB | 3zcg_A | 9.80909e-45 | 4 | 122 | 137 | 256 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
| PDB | 2y6b_A | 9.80909e-45 | 4 | 122 | 125 | 244 | A Chain A, Ascorbate Peroxidase R38k Mutant |
| PDB | 3zch_A | 9.80909e-45 | 4 | 122 | 137 | 256 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DR527312 | 122 | 1 | 122 | 0 |
| DR509189 | 122 | 1 | 122 | 0 |
| EX369523 | 122 | 1 | 122 | 0 |
| ES262625 | 122 | 1 | 122 | 0 |
| DR483378 | 122 | 1 | 122 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
