Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_23907g0010 |
Family | AA2 |
Protein Properties | Length: 138 Molecular Weight: 15342.6 Isoelectric Point: 5.9887 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 3 | 97 | 1.5e-21 |
NQAEPAHGTKNGLDIASKLLELVREQFPLISYAHSYQLAGVVAIEVTGGPGIPFHLGKEDKLEPLVKGSISDATQEYDSWRVVFGHMELNDREIV |
Full Sequence |
---|
Protein Sequence Length: 138 Download |
MSNQAEPAHG TKNGLDIASK LLELVREQFP LISYAHSYQL AGVVAIEVTG GPGIPFHLGK 60 EDKLEPLVKG SISDATQEYD SWRVVFGHME LNDREIVLGD AKKGDLGLKD QGPLILYSLI 120 PLIFPIRRQQ SWHITCFF |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 2.0e-11 | 3 | 97 | 102 | + Peroxidase. | ||
PLN02608 | PLN02608 | 2.0e-22 | 3 | 97 | 95 | + L-ascorbate peroxidase | ||
PLN02364 | PLN02364 | 9.0e-28 | 1 | 97 | 98 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 1.0e-28 | 6 | 116 | 121 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 1.0e-30 | 1 | 97 | 100 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAR32786.1 | 4e-33 | 1 | 124 | 60 | 185 | ascorbate peroxidase [Pinus pinaster] |
GenBank | ABK23188.1 | 1e-33 | 1 | 124 | 60 | 185 | unknown [Picea sitchensis] |
GenBank | ABK26904.1 | 8e-34 | 1 | 124 | 25 | 150 | unknown [Picea sitchensis] |
GenBank | ABK93153.1 | 3e-32 | 1 | 97 | 60 | 156 | unknown [Populus trichocarpa] |
EMBL | CAD33265.1 | 2e-32 | 1 | 97 | 60 | 157 | ascorbate peroxidase [Crocus sativus] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 1e-31 | 1 | 124 | 59 | 185 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 1e-31 | 1 | 124 | 59 | 185 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 1e-31 | 1 | 124 | 59 | 185 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 1e-31 | 1 | 124 | 59 | 185 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 3zch_A | 3e-28 | 1 | 124 | 71 | 197 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CV034439 | 119 | 1 | 112 | 6e-36 |
EX424537 | 131 | 1 | 124 | 4e-35 |
AM175563 | 131 | 1 | 124 | 1e-34 |
AM171168 | 131 | 1 | 124 | 2e-34 |
DV972241 | 131 | 1 | 124 | 4e-34 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|