| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_2409806g0010 |
| Family | CE8 |
| Protein Properties | Length: 87 Molecular Weight: 9604.89 Isoelectric Point: 8.9662 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 20 | 87 | 1.4e-24 |
| AMVAKDDSGNYMNITEAVQAAPEKSKTRYVIHIKEGVYAENVEFHKNKTNLMFIGDGMDVTVVTGNRN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 87 Download |
| MSVGDRRILQ TSTGTVKPNA MVAKDDSGNY MNITEAVQAA PEKSKTRYVI HIKEGVYAEN 60 VEFHKNKTNL MFIGDGMDVT VVTGNRN |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02314 | PLN02314 | 2.0e-26 | 2 | 87 | 86 | + pectinesterase | ||
| PLN02313 | PLN02313 | 3.0e-27 | 1 | 87 | 87 | + Pectinesterase/pectinesterase inhibitor | ||
| PLN02201 | PLN02201 | 4.0e-30 | 4 | 87 | 84 | + probable pectinesterase/pectinesterase inhibitor | ||
| PLN02301 | PLN02301 | 6.0e-31 | 5 | 87 | 83 | + pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 3.0e-32 | 19 | 87 | 69 | + Pectinesterase. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAZ20274.1 | 1e-27 | 1 | 87 | 69 | 153 | putative pectin methylesterase [Nicotiana attenuata] |
| GenBank | ABG46324.1 | 1.4013e-45 | 1 | 87 | 227 | 313 | putative pectin methylesterase [Picea abies] |
| GenBank | ABQ42392.1 | 2e-27 | 1 | 87 | 264 | 350 | pectin methylesterase-like protein [Taiwania cryptomerioides] |
| GenBank | ABZ89800.1 | 9e-31 | 1 | 87 | 254 | 340 | pectin methylesterase-like protein [Taiwania cryptomerioides] |
| GenBank | ACN40984.1 | 1e-27 | 1 | 87 | 271 | 357 | unknown [Picea sitchensis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 6e-23 | 13 | 87 | 2 | 76 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 4e-22 | 19 | 87 | 4 | 72 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 3uw0_A | 0.006 | 19 | 85 | 32 | 96 | A Chain A, Pectin Methylesterase From Yersinia Enterocolitica |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| AM174579 | 87 | 1 | 87 | 0 |
| DV972440 | 87 | 1 | 87 | 0 |
| FE523419 | 87 | 1 | 87 | 8.40779e-45 |
| DR386802 | 87 | 1 | 87 | 1.96182e-44 |
| BQ702503 | 80 | 8 | 87 | 2e-40 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |