Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_28841g0010 |
Family | AA6 |
Protein Properties | Length: 163 Molecular Weight: 18672.5 Isoelectric Point: 9.6417 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 90 | 158 | 4.9e-22 |
TAITQLAHHGMLFVPIGYTFGAGMFKMDEIRGGSPYGAGVYAGDGTRQPSSVELALAEHQGKYMAAVVN |
Full Sequence |
---|
Protein Sequence Length: 163 Download |
MSPLLLHFSK YNLGFHHKTL ISKSLIDETL TLDFKMLQQD QETLATLRER ERERERERER 60 ERDIRRSKRE REKISVLYLI TSLTQVCSWT AITQLAHHGM LFVPIGYTFG AGMFKMDEIR 120 GGSPYGAGVY AGDGTRQPSS VELALAEHQG KYMAAVVNRL VKA |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG0655 | WrbA | 2.0e-8 | 95 | 162 | 68 | + Multimeric flavodoxin WrbA [General function prediction only] |
TIGR01755 | flav_wrbA | 4.0e-19 | 90 | 160 | 72 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. |
PRK03767 | PRK03767 | 3.0e-23 | 92 | 161 | 71 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABR16990.1 | 0 | 85 | 163 | 194 | 272 | unknown [Picea sitchensis] |
DDBJ | BAF26586.2 | 1.99993e-41 | 88 | 163 | 8 | 83 | Os10g0436800 [Oryza sativa Japonica Group] |
EMBL | CBI17562.1 | 2.99878e-43 | 78 | 163 | 62 | 152 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002273030.1 | 3.99931e-42 | 78 | 163 | 166 | 256 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002525103.1 | 8.99998e-41 | 85 | 163 | 179 | 257 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 7e-16 | 84 | 160 | 123 | 196 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 3b6m_A | 7e-16 | 84 | 160 | 123 | 196 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 3b6k_B | 7e-16 | 84 | 160 | 123 | 196 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 3b6k_A | 7e-16 | 84 | 160 | 123 | 196 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 3b6j_B | 7e-16 | 84 | 160 | 123 | 196 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GW726925 | 79 | 85 | 163 | 0 |
EX335842 | 79 | 85 | 163 | 0 |
EX335499 | 79 | 85 | 163 | 0 |
CO210044 | 79 | 85 | 163 | 0 |
CO480084 | 77 | 87 | 163 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |