Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_311901g0010 |
Family | GH47 |
Protein Properties | Length: 108 Molecular Weight: 13006.8 Isoelectric Point: 5.8638 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH47 | 18 | 107 | 9.9e-30 |
RIHRLTWTCYNFYNSTRTKLAGENYIFNEGQDMVVGTSWNIMRPETIESLMYLWRITGNETYRDWGWDIFQAFEKQARIDSGYVGLRDVR |
Full Sequence |
---|
Protein Sequence Length: 108 Download |
MRVLVALACL WLYEAEQRIH RLTWTCYNFY NSTRTKLAGE NYIFNEGQDM VVGTSWNIMR 60 PETIESLMYL WRITGNETYR DWGWDIFQAF EKQARIDSGY VGLRDVRY |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
PTZ00470 | PTZ00470 | 8.0e-28 | 20 | 106 | 90 | + glycoside hydrolase family 47 protein; Provisional |
pfam01532 | Glyco_hydro_47 | 1.0e-31 | 21 | 107 | 96 | + Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2). |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI18482.1 | 1.00053e-42 | 22 | 106 | 185 | 269 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001031171.1 | 3.00018e-42 | 22 | 106 | 301 | 385 | mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Arabidopsis thaliana] |
RefSeq | NP_001053800.1 | 3.99931e-42 | 22 | 106 | 411 | 495 | Os04g0606400 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002448484.1 | 3.00018e-42 | 22 | 106 | 409 | 493 | hypothetical protein SORBIDRAFT_06g027810 [Sorghum bicolor] |
RefSeq | XP_002528166.1 | 1.00053e-42 | 22 | 106 | 363 | 447 | mannosyl-oligosaccharide alpha-1,2-mannosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1nxc_A | 4e-17 | 25 | 106 | 332 | 416 | A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases) |
PDB | 1x9d_A | 0.00000000000007 | 20 | 107 | 389 | 484 | A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue |
PDB | 1fo3_A | 0.0000000000002 | 20 | 107 | 311 | 406 | A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue |
PDB | 1fo2_A | 0.0000000000002 | 20 | 107 | 311 | 406 | A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin |
PDB | 1fmi_A | 0.0000000000002 | 20 | 107 | 311 | 406 | A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase |