y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_34515g0010
FamilyCE13
Protein PropertiesLength: 114 Molecular Weight: 12676.3 Isoelectric Point: 4.3128
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1311100
  MDKAQQTLLSGCSAGGLTSFLHCDSFKELLPETVEVKCLGDAGFFIDEPDITGFYHIRSYFNEVVTLQGSAKNLPLDCTSTMYSSQCFFPQYLLPYINTP
  NFVLNAAFDQ
Full Sequence
Protein Sequence     Length: 114     Download
MDKAQQTLLS GCSAGGLTSF LHCDSFKELL PETVEVKCLG DAGFFIDEPD ITGFYHIRSY    60
FNEVVTLQGS AKNLPLDCTS TMYSSQCFFP QYLLPYINTP NFVLNAAFDQ GRQP          120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE2.0e-481110110+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK24433.11.4013e-451109166273unknown [Picea sitchensis]
GenBankABK24994.11.4013e-451109166273unknown [Picea sitchensis]
GenBankABK26312.12.00386e-431109190299unknown [Picea sitchensis]
GenBankABR16604.11.99993e-411109203311unknown [Picea sitchensis]
RefSeqXP_002519911.19.99967e-421109162270pectin acetylesterase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GE47998110911090
DV99551010911090
EX93215710911090
FY84261611111090
EX37355510911090
Orthologous Group
SpeciesID
Arabidopsis lyrata897101.227.332897101.227.332897101.227.332
Glycine maxGlyma06g22110.1
Linum usitatissimumLus10025347.176.262Lus10025347.176.262
Medicago truncatulaMedtr7g006750.1
Panicum virgatumPavirv00060334m.225.308Pavirv00060334m.225.308
Picea abiesMA_10306500g0010
Prunus persicappb014879m
Setaria italicaSi002502m.79.158Si002502m.79.158
Sorghum bicolorSb03g042390.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny