y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_35878g0010 |
Family | GH116 |
Protein Properties | Length: 84 Molecular Weight: 9237.19 Isoelectric Point: 3.9356 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH116 | 4 | 82 | 2.5e-32 |
IGDKSFAHAVWPSVYMVMAYMDHFDQDKDGMIENEGFQDQTYDAWPISGVSAYSGGLWVASFQAATAMADEAGDKASRE |
Full Sequence |
---|
Protein Sequence Length: 84 Download |
MVAIGDKSFA HAVWPSVYMV MAYMDHFDQD KDGMIENEGF QDQTYDAWPI SGVSAYSGGL 60 WVASFQAATA MADEAGDKAS RENF 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd07866 | STKc_BUR1 | 0.001 | 15 | 41 | 27 | + Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic screen as factors involved in general transcription. The BUR1/BUR2 complex phosphorylates the C-terminal domain of RNA polymerase II. In addition, this complex regulates histone modification by phosporylating Rad6 and mediating the association of the Paf1 complex with chromatin. | ||
COG4354 | COG4354 | 5.0e-16 | 5 | 82 | 78 | + Predicted bile acid beta-glucosidase [Carbohydrate transport and metabolism] | ||
pfam04685 | DUF608 | 5.0e-28 | 5 | 84 | 80 | + Protein of unknown function, DUF608. This family represents a conserved region with a pankaryotic distribution in a number of uncharacterized proteins. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAF97289.1 | 4e-29 | 1 | 80 | 472 | 551 | AC010164_11 Hypothetical protein [Arabidopsis thaliana] |
GenBank | AAO42222.1 | 6e-29 | 1 | 80 | 629 | 708 | unknown protein [Arabidopsis thaliana] |
GenBank | AAX95400.1 | 3e-28 | 1 | 84 | 620 | 703 | At5g49900 [Oryza sativa Japonica Group] |
RefSeq | NP_174631.2 | 6e-29 | 1 | 80 | 629 | 708 | catalytic/ glucosylceramidase [Arabidopsis thaliana] |
RefSeq | XP_002325943.1 | 2e-30 | 1 | 84 | 580 | 663 | predicted protein [Populus trichocarpa] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX422883 | 84 | 1 | 84 | 8e-37 |
GO367803 | 84 | 1 | 84 | 1e-36 |
GW760060 | 84 | 1 | 84 | 5e-34 |
CA917117 | 84 | 1 | 84 | 1e-33 |
FN758942 | 79 | 1 | 79 | 8e-32 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|