CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_3930037g0010
FamilyAA2
Protein PropertiesLength: 121 Molecular Weight: 12667.7 Isoelectric Point: 8.9365
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA221214.1e-35
  VQGCDGSVLLNSTKSRKAEKEAAPNLTLRGFQIIDAAKAAVEKVCPGVVSCADILALVARDAVHMLGGPFWNVPTGRRDGLVSIQNEAVAKLPPPNGTFS
  KLKSIFASNGLDVKDLVVLS
Full Sequence
Protein Sequence     Length: 121     Download
LVQGCDGSVL LNSTKSRKAE KEAAPNLTLR GFQIIDAAKA AVEKVCPGVV SCADILALVA    60
RDAVHMLGGP FWNVPTGRRD GLVSIQNEAV AKLPPPNGTF SKLKSIFASN GLDVKDLVVL    120

Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02608PLN026080.00025012172+
cd00314plant_peroxidase_like2.0e-64121123+
PLN03030PLN030301.0e-361120120+
pfam00141peroxidase1.0e-482121121+
cd00693secretory_peroxidase5.0e-712121120+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK26805.10112171191unknown [Picea sitchensis]
EMBLCBI28955.10112172192unnamed protein product [Vitis vinifera]
EMBLCBI28956.10112172192unnamed protein product [Vitis vinifera]
RefSeqXP_002274157.10112171191PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002280216.10112172192PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A1e-33112145166A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1sch_B3e-33112145166A Chain A, Peanut Peroxidase
PDB1sch_A3e-33112145166A Chain A, Peanut Peroxidase
PDB1fhf_C1e-30112145166A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_B1e-30112145166A Chain A, The Structure Of Soybean Peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR53129512111210
CO22985912111210
EX30936712111210
GT73864412111210
DV98741012111210
Orthologous Group
SpeciesID
Brassica rapaBra008715
Carica papayaevm.model.supercontig_16.92evm.model.supercontig_2186.1
Citrus sinensisorange1.1g041339m
Eucalyptus grandisEucgr.L01603.1Eucgr.H03669.1Eucgr.H03668.1
Malus domesticaMDP0000572590
Mimulus guttatusmgv1a014238m
Panicum virgatumPavirv00056620mPavirv00020581mPavirv00056619mPavirv00054667mPavirv00057804m
Pavirv00055510mPavirv00021339m
Picea abiesMA_946965g0010MA_10433598g0020MA_48212g0010MA_149004g0010MA_142961g0010
MA_7571130g0010MA_10431507g0030
Populus trichocarpaPotri.T106200.1
Ricinus communis29726.m003967
Setaria italicaSi003834m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny