Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_41304g0010 |
Family | CBM57 |
Protein Properties | Length: 106 Molecular Weight: 11911.9 Isoelectric Point: 9.0444 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM57 | 2 | 90 | 5e-25 |
NYLFKVEPNSKYSIWLHFAEIEDGVRSAGQRVFDVLINGQLLVSKVDIVRMAGGPFAAVVLNRTVAIDGRTLMLSFKPQRQSTAMVNAI |
Full Sequence |
---|
Protein Sequence Length: 106 Download |
MNYLFKVEPN SKYSIWLHFA EIEDGVRSAG QRVFDVLING QLLVSKVDIV RMAGGPFAAV 60 VLNRTVAIDG RTLMLSFKPQ RQSTAMVNAI EILQVIQMEK KTIDTE |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam11721 | Malectin | 2.0e-14 | 1 | 78 | 79 | + Di-glucose binding within endoplasmic reticulum. Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan. | ||
pfam12819 | Malectin_like | 2.0e-18 | 7 | 95 | 92 | + Carbohydrate-binding protein of the ER. Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. The domain is found on a number of plant receptor kinases. | ||
PLN03150 | PLN03150 | 7.0e-42 | 1 | 106 | 106 | + hypothetical protein; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI30598.1 | 5e-30 | 1 | 106 | 270 | 375 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_174156.1 | 4e-29 | 1 | 106 | 271 | 376 | AtRLP4 (Receptor Like Protein 4); protein binding [Arabidopsis thaliana] |
RefSeq | XP_002279791.1 | 4e-30 | 1 | 106 | 244 | 349 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002462899.1 | 5e-29 | 1 | 106 | 283 | 388 | hypothetical protein SORBIDRAFT_02g034070 [Sorghum bicolor] |
RefSeq | XP_002509445.1 | 3e-29 | 1 | 106 | 276 | 381 | serine-threonine protein kinase, plant-type, putative [Ricinus communis] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CK435942 | 98 | 9 | 106 | 0 |
GE473587 | 98 | 9 | 106 | 0 |
DV997978 | 98 | 9 | 106 | 0 |
ES227724 | 106 | 1 | 106 | 0 |
ES227609 | 106 | 1 | 106 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|