CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_427851g0010
FamilyGH28
Protein PropertiesLength: 255 Molecular Weight: 26223.1 Isoelectric Point: 4.0258
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2811820
  MIQNCTIATGDDCISIVTESSDIQINELICGPGHGISIGSLGKYNTKDTVSDVVVNGASLSGTQNGLRIKTWQGGSGYAQGIIFQHVKMINVSNPIIIDQ
  NYCAPSSPCQNQPTPICNNQSSAVQVNNVTYTDITGTSATQDAIKLACSATAPCTNIVLEDISLQLSNGDTASSLSANVQGS
Full Sequence
Protein Sequence     Length: 255     Download
MIQNCTIATG DDCISIVTES SDIQINELIC GPGHGISIGS LGKYNTKDTV SDVVVNGASL    60
SGTQNGLRIK TWQGGSGYAQ GIIFQHVKMI NVSNPIIIDQ NYCAPSSPCQ NQPTPICNNQ    120
SSAVQVNNVT YTDITGTSAT QDAIKLACSA TAPCTNIVLE DISLQLSNGD TASSLSANVQ    180
GSSNGQVTPP VNFSFTGTSA TQDAIKLACS ATAPCTNIVL EDISLQLNNG DTASSLSANV    240
QGSSNGQVTP PVNFS                                                     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02793PLN027932.0e-1219225567+
PLN02218PLN022182.0e-462192191+
pfam00295Glyco_hydro_287.0e-472176175+
PLN02793PLN027932.0e-682204203+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK23977.101194245436unknown [Picea sitchensis]
GenBankABK26513.101194232425unknown [Picea sitchensis]
GenBankACN40008.101194245436unknown [Picea sitchensis]
Swiss-ProtP3533602189274453PGLR_ACTDE RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; Flags: Precursor
RefSeqXP_002517603.102202222414Polygalacturonase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bhe_A0.0000000000067102219314A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1rmg_A0.00000000041182187356A Chain A, Rhamnogalacturonase A From Aspergillus Aculeatus
PDB2iq7_G0.00000000311164176319A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_F0.00000000311164176319A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_E0.00000000311164176319A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO21234919411940
CO48165419411940
CO48141419411940
CO212349611952553e-27
CO481654611952552e-26
Orthologous Group
SpeciesID
Glycine maxGlyma03g29431.1
Malus domesticaMDP0000181630
Panicum virgatumPavirv00028280m
Phaseolus vulgarisPhvul.007G253100.1
Picea abiesMA_61518g0010MA_9231294g0010MA_10431579g0010MA_366599g0010
Selaginella moellendorffii113633.248.413113633.248.413
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny