CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_432761g0010
FamilyGT1
Protein PropertiesLength: 490 Molecular Weight: 54997 Isoelectric Point: 8.1166
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12734377.00649e-45
  ELEWLDHRSARSVVYVSFGSQSLISSSQIIELALGLEASGKPFLWVLRLPDSHDDNPTLDGFYRRTGQRGRIVRGWADQLAILSHPSVGAFITHCGWNST
  LEAICAGIPLICWPLFADQHFNARFIVDEAKAGIEVVKRDEDQMVTRDEIEKSVRTLMDDDHSGG
Full Sequence
Protein Sequence     Length: 490     Download
MAAPAPAPHL FLLPSLGIGH LIPFTELAKR LAARRFLVSF FVSSDHGLSI ARNKIADAAN    60
IRIVELHLSH QINTQPSHSK SCASDQILLM NHTLLQDAFQ KLLVSEENKN GFRLMYPPPL    120
CIVTDFLLSW TVTIAAKLGI PRVNVECTPA YSQNLFEALW SKLPRNLERS SSGRYIVPHQ    180
ARRTLLSRSQ MPPELPDADE THFTHKMSRE YFRLTKQSWM NITNSFHELE GDHVIEFQKR    240
YAGPVKPIGP LLPDSFLSGQ YLTTPTARLA SAELEWLDHR SARSVVYVSF GSQSLISSSQ    300
IIELALGLEA SGKPFLWVLR LPDSHDDNPT LDGFYRRTGQ RGRIVRGWAD QLAILSHPSV    360
GAFITHCGWN STLEAICAGI PLICWPLFAD QHFNARFIVD EAKAGIEVVK RDEDQMVTRD    420
EIEKSVRTLM DDDHSGGETV KSLKENCNRL KEMGKKAVSE NGSSSKNFNM FVEDIMSLQN    480
KKKNPVSNSM 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025552.0e-5417488491+
PLN03007PLN030071.0e-5819479478+
PLN02863PLN028638.0e-6519478483+
PLN02448PLN024486.0e-6817475478+
PLN02534PLN025341.0e-7319482499+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABR18046.10947818504unknown [Picea sitchensis]
GenBankABR18361.101514802342unknown [Picea sitchensis]
GenBankABR18451.1084789486unknown [Picea sitchensis]
GenBankACN40348.1094847494unknown [Picea sitchensis]
DDBJBAB86927.1074848489glucosyltransferase-9 [Vigna angularis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A084707462A Chain A, High Resolution Crystal Structure Of Beta-Porphyranase A From Zobellia Galactanivorans
PDB2vch_A084707462A Chain A, High Resolution Crystal Structure Of Beta-Porphyranase A From Zobellia Galactanivorans
PDB2vce_A084707462A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A084809482A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acv_B9.00054e-42947511461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX3933322961184130
DV9923202632284900
GR2227432392524900
CO1710822611754350
CX6460032212704900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00895.1Aquca_009_00215.1Aquca_009_00214.1
Arabidopsis lyrata909236
Arabidopsis thalianaAT5G12890.1
Brachypodium distachyonBradi5g15060.1
Brassica rapaBra008873
Carica papayaevm.model.supercontig_84.97
Capsella rubellaCarubv10003346m
Citrus clementinaCiclev10017842mCiclev10000917mCiclev10027266mCiclev10015056mCiclev10017937m
Ciclev10015021mCiclev10015029mCiclev10015045mCiclev10015019mCiclev10017546m
Ciclev10016844m
Citrus sinensisorange1.1g041323morange1.1g035495morange1.1g042731morange1.1g011106morange1.1g043168m
orange1.1g043304morange1.1g047833morange1.1g040467m
Cucumis sativusCucsa.094380.1Cucsa.065340.1
Eucalyptus grandisEucgr.J00809.1Eucgr.H02623.1Eucgr.H00447.1Eucgr.H00444.1Eucgr.H00443.1
Eucgr.H00446.1
Fragaria vescamrna22484.1-v1.0-hybrid
Glycine maxGlyma14g04790.1Glyma02g44100.1Glyma14g04800.1Glyma14g04811.1Glyma15g03670.1
Gossypium raimondiiGorai.004G091900.1Gorai.005G017000.1Gorai.007G232800.1
Linum usitatissimumLus10031248Lus10031819Lus10025513Lus10025515
Malus domesticaMDP0000718378MDP0000244877MDP0000315574MDP0000191048MDP0000268507
MDP0000888095MDP0000423529MDP0000893993MDP0000796379MDP0000618774
MDP0000611903MDP0000264453
Manihot esculentacassava4.1_005848mcassava4.1_033842mcassava4.1_034196m
Medicago truncatulaMedtr5g087620.1Medtr2g098430.1
Mimulus guttatusmgv11b017767mmgv1a019043m
Oryza sativaLOC_Os04g20474.4LOC_Os04g20474.3LOC_Os04g20474.2LOC_Os04g20474.1LOC_Os04g42690.1
LOC_Os04g20260.1LOC_Os04g20330.1LOC_Os04g20540.1
Panicum virgatumPavirv00043406mPavirv00039645mPavirv00049770mPavirv00039309mPavirv00069822m
Pavirv00019348mPavirv00023527m
Physcomitrella patensPp1s45_276V6.1Pp1s46_163V6.1Pp1s232_57V6.1Pp1s73_170V6.1Pp1s44_128V6.1
Pp1s339_8V6.1
Phaseolus vulgarisPhvul.008G208400.1Phvul.008G208500.1Phvul.008G208600.1Phvul.005G149900.1
Picea abiesMA_2420g0020MA_508766g0010MA_173074g0010MA_6763613g0010MA_901161g0010
MA_619336g0010MA_10433869g0010MA_10427810g0010MA_104361g0010MA_8779645g0010
MA_7909224g0010MA_47308g0010MA_365297g0010MA_10426944g0020MA_9569707g0010
MA_26811g0010MA_407162g0010MA_495649g0010MA_103636g0020MA_4331330g0010
MA_10436818g0020MA_6456g0020MA_10426647g0010MA_70127g0010MA_10431618g0010
MA_237379g0010MA_10427592g0020MA_10434729g0020MA_10182116g0010MA_103506g0010
MA_333155g0010MA_95818g0010MA_10425895g0020MA_158042g0010MA_220754g0010
MA_10417695g0010MA_201086g0010MA_8682761g0010MA_9188108g0010MA_551352g0010
MA_263300g0010MA_10429280g0010MA_8649321g0010MA_1132847g0010
Populus trichocarpaPotri.001G016300.1Potri.017G077500.1Potri.017G077800.1Potri.017G077400.1Potri.017G077700.1
Potri.003G210400.1Potri.001G016500.1
Prunus persicappa016005mppa022989mppa021821mppa004601mppa023949m
ppa015738m
Ricinus communis30169.m00639829888.m00032529888.m000328
Setaria italicaSi012787mSi035407mSi012786mSi011731m
Sorghum bicolorSb03g007940.1Sb06g021900.1Sb06g020400.1Sb09g026740.1Sb01g047220.1
Sb01g014390.1
Thellungiella halophilaThhalv10015476m
Vitis viniferaGSVIVT01031678001GSVIVT01025320001.143.342GSVIVT01025320001.143.342GSVIVT01025320001.570.722GSVIVT01025320001.570.722
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)