Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_445446g0010 |
Family | AA2 |
Protein Properties | Length: 110 Molecular Weight: 11707.5 Isoelectric Point: 4.5743 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 1 | 98 | 3.2e-27 |
GMNGSIIYELDRPANAGLDRSVKVLEKVKAVLDLIMQVSWADLIALAGVEALALCGGPIILIKLGRQDTKSPDPDGELPAESLNASDLKECFQRKGFS |
Full Sequence |
---|
Protein Sequence Length: 110 Download |
GMNGSIIYEL DRPANAGLDR SVKVLEKVKA VLDLIMQVSW ADLIALAGVE ALALCGGPII 60 LIKLGRQDTK SPDPDGELPA ESLNASDLKE CFQRKGFSYV SSSLYASILG |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02608 | PLN02608 | 2.0e-13 | 1 | 98 | 100 | + L-ascorbate peroxidase | ||
cd08201 | plant_peroxidase_like_1 | 8.0e-16 | 1 | 98 | 100 | + Uncharacterized family of plant peroxidase-like proteins. This is a subgroup of heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX) which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. | ||
cd00314 | plant_peroxidase_like | 3.0e-24 | 1 | 98 | 107 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
cd00691 | ascorbate_peroxidase | 6.0e-25 | 1 | 98 | 103 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
pfam00141 | peroxidase | 5.0e-27 | 1 | 98 | 106 | + Peroxidase. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU18323.1 | 1e-38 | 1 | 98 | 126 | 223 | unknown [Glycine max] |
GenBank | EAZ07678.1 | 2e-36 | 1 | 98 | 138 | 235 | hypothetical protein OsI_29935 [Oryza sativa Indica Group] |
GenBank | EAZ43377.1 | 2e-36 | 1 | 98 | 138 | 235 | hypothetical protein OsJ_27981 [Oryza sativa Japonica Group] |
RefSeq | NP_001062280.1 | 2e-37 | 1 | 98 | 20 | 117 | Os08g0522400 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002282677.1 | 3e-38 | 1 | 98 | 137 | 234 | PREDICTED: similar to APX6 (ASCORBATE PEROXIDASE 6); L-ascorbate peroxidase [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3zcy_A | 0.000000000002 | 1 | 94 | 54 | 146 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 2xj6_A | 0.000000000002 | 1 | 94 | 54 | 146 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 2xih_A | 0.000000000002 | 1 | 94 | 54 | 146 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 2xif_A | 0.000000000002 | 1 | 94 | 54 | 146 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2xi6_A | 0.000000000002 | 1 | 94 | 54 | 146 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO488325 | 98 | 1 | 98 | 0 |
ES863371 | 98 | 1 | 98 | 0 |
GW746331 | 98 | 1 | 98 | 0 |
GW741547 | 88 | 1 | 88 | 1.4013e-45 |
BG882661 | 98 | 1 | 98 | 9.99995e-41 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|