Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_448717g0010 |
Family | GT1 |
Protein Properties | Length: 114 Molecular Weight: 12365.2 Isoelectric Point: 4.7147 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 3 | 106 | 1.3e-23 |
QPGSVIYVSSGSIAVKSEQQLEQVALGLENSGQPFLWVLRLDTAEGQSAILPGDFEERTKESALFVKWAPQSKVLAHVSVGLFLTHCGWNSMLESMSMGV PVVA |
Full Sequence |
---|
Protein Sequence Length: 114 Download |
MQQPGSVIYV SSGSIAVKSE QQLEQVALGL ENSGQPFLWV LRLDTAEGQS AILPGDFEER 60 TKESALFVKW APQSKVLAHV SVGLFLTHCG WNSMLESMSM GVPVVADGTL CWRA 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02670 | PLN02670 | 1.0e-27 | 2 | 104 | 107 | + transferase, transferring glycosyl groups | ||
PLN02554 | PLN02554 | 1.0e-27 | 2 | 106 | 115 | + UDP-glycosyltransferase family protein | ||
PLN00164 | PLN00164 | 7.0e-29 | 2 | 105 | 113 | + glucosyltransferase; Provisional | ||
PLN03007 | PLN03007 | 4.0e-29 | 2 | 105 | 106 | + UDP-glucosyltransferase family protein | ||
PLN02555 | PLN02555 | 2.0e-31 | 2 | 106 | 107 | + limonoid glucosyltransferase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK24576.1 | 0 | 1 | 105 | 299 | 403 | unknown [Picea sitchensis] |
GenBank | ABK25749.1 | 0 | 1 | 106 | 1 | 106 | unknown [Picea sitchensis] |
GenBank | ABR16235.1 | 0 | 1 | 105 | 299 | 403 | unknown [Picea sitchensis] |
GenBank | ABR16924.1 | 0 | 1 | 105 | 158 | 262 | unknown [Picea sitchensis] |
GenBank | ABR17103.1 | 0 | 1 | 105 | 295 | 399 | unknown [Picea sitchensis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 1e-28 | 2 | 112 | 292 | 397 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vg8_A | 5e-24 | 2 | 106 | 264 | 382 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vch_A | 5e-24 | 2 | 106 | 264 | 382 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vce_A | 5e-24 | 2 | 106 | 264 | 382 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 3hbj_A | 5e-23 | 6 | 106 | 274 | 370 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
HE632266 | 105 | 1 | 105 | 0 |
EX377901 | 105 | 1 | 105 | 0 |
FD745829 | 105 | 1 | 105 | 0 |
DR015938 | 106 | 1 | 106 | 0 |
DR532092 | 106 | 1 | 106 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|