y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_4826396g0010 |
Family | CE10 |
Protein Properties | Length: 109 Molecular Weight: 11664 Isoelectric Point: 4.4937 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE10 | 5 | 100 | 2.2e-24 |
ALIISVNYRLAPEHCLPAAYDDCCDAVEWVARAGGKAEPWIDTYADYGHCFLAGESAGGNIAHVVGSRSANRDLGPLNIRGLIVIHPYFGSEERIE |
Full Sequence |
---|
Protein Sequence Length: 109 Download |
ATASALIISV NYRLAPEHCL PAAYDDCCDA VEWVARAGGK AEPWIDTYAD YGHCFLAGES 60 AGGNIAHVVG SRSANRDLGP LNIRGLIVIH PYFGSEERIE CEKVVTGDD 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam10928 | DUF2810 | 0.006 | 77 | 107 | 35 | + Protein of unknown function (DUF2810). This is a bacterial family of uncharacterized proteins. | ||
PRK10162 | PRK10162 | 0.005 | 7 | 94 | 94 | + acetyl esterase; Provisional | ||
COG0657 | Aes | 3.0e-11 | 1 | 91 | 91 | + Esterase/lipase [Lipid metabolism] | ||
pfam07859 | Abhydrolase_3 | 1.0e-24 | 1 | 91 | 91 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD04946.2 | 0 | 1 | 109 | 101 | 209 | PrMC3 [Pinus radiata] |
GenBank | ACJ12922.1 | 1e-28 | 4 | 109 | 33 | 135 | HSR203J-like protein [Brassica juncea] |
GenBank | ACO49546.1 | 5e-28 | 4 | 108 | 22 | 123 | HSR203J-like protein [Brassica juncea] |
RefSeq | XP_002285090.1 | 9e-28 | 3 | 103 | 144 | 242 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002511752.1 | 1e-28 | 5 | 108 | 121 | 230 | Gibberellin receptor GID1, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2o7v_A | 6e-25 | 3 | 108 | 115 | 219 | A Chain A, Crystal Structure Of Galactose Oxidase Complexed With Azide |
PDB | 2o7r_A | 6e-25 | 3 | 108 | 115 | 219 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 2zsi_A | 5e-17 | 6 | 107 | 148 | 242 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 2zsh_A | 5e-17 | 6 | 107 | 148 | 242 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
PDB | 3ed1_F | 0.000000000000002 | 3 | 107 | 144 | 241 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CT583609 | 109 | 1 | 109 | 0 |
CT576478 | 109 | 1 | 109 | 0 |
CT575591 | 109 | 1 | 109 | 0 |
CT576271 | 93 | 17 | 109 | 0 |
DR064554 | 111 | 1 | 109 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|