| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_501421g0010 |
| Family | GH9 |
| Protein Properties | Length: 118 Molecular Weight: 13247.9 Isoelectric Point: 4.7974 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH9 | 8 | 118 | 1.80067e-42 |
| NYRDALSKSIMFFEGQRSGKLPANQRLNWRKDSALADGSDENVDLVGGYYDAGDNLKFGFPMAFTTTMLSWSVIEFGRAMGDELENAKNSIRWATDYLLK AAAYPDTLYVQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 118 Download |
| MAATVFHNYR DALSKSIMFF EGQRSGKLPA NQRLNWRKDS ALADGSDENV DLVGGYYDAG 60 DNLKFGFPMA FTTTMLSWSV IEFGRAMGDE LENAKNSIRW ATDYLLKAAA YPDTLYVQ 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN00119 | PLN00119 | 6.0e-51 | 8 | 118 | 113 | + endoglucanase | ||
| PLN02171 | PLN02171 | 1.0e-51 | 7 | 116 | 112 | + endoglucanase | ||
| pfam00759 | Glyco_hydro_9 | 2.0e-57 | 8 | 118 | 113 | + Glycosyl hydrolase family 9. | ||
| PLN02308 | PLN02308 | 2.0e-62 | 7 | 118 | 112 | + endoglucanase | ||
| PLN02266 | PLN02266 | 2.0e-68 | 7 | 118 | 112 | + endoglucanase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAA85150.1 | 0 | 7 | 118 | 41 | 152 | endo-1,4-beta-glucanase [Pisum sativum] |
| RefSeq | NP_192138.1 | 0 | 7 | 118 | 51 | 162 | AtGH9B13 (Arabidopsis thaliana glycosyl hydrolase 9B13); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds |
| RefSeq | XP_002271736.1 | 0 | 7 | 118 | 46 | 157 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002320998.1 | 0 | 7 | 118 | 45 | 156 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002523114.1 | 0 | 7 | 118 | 45 | 156 | endo-1,4-beta-glucanase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4tf4_B | 3e-36 | 8 | 118 | 5 | 117 | C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) |
| PDB | 4tf4_A | 3e-36 | 8 | 118 | 5 | 117 | C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) |
| PDB | 3tf4_B | 3e-36 | 8 | 118 | 5 | 117 | C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) |
| PDB | 3tf4_A | 3e-36 | 8 | 118 | 5 | 117 | C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) |
| PDB | 1tf4_B | 3e-36 | 8 | 118 | 5 | 117 | C Chain C, Crystal Structure Of Clostridium Botulinum Neurotoxin Serotype F Catalytic Domain With An Inhibitor (Inh1) |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DR558818 | 112 | 7 | 118 | 0 |
| GW757823 | 112 | 7 | 118 | 0 |
| GW757465 | 112 | 7 | 118 | 0 |
| BY895075 | 112 | 7 | 118 | 0 |
| DR460126 | 112 | 7 | 118 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |