Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_5039622g0010 |
Family | CBM43 |
Protein Properties | Length: 100 Molecular Weight: 10343 Isoelectric Point: 5.4425 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 29 | 99 | 1.3e-31 |
WCVANSKSDTSKLQAALDYACGEGDADCQQIQPGAPCYNPNTLEAHASYAFNSYYEKNSRKIGTCDFAGAA |
Full Sequence |
---|
Protein Sequence Length: 100 Download |
SGNSSSSTPA VSAHHHSSGT TPAGGSETWC VANSKSDTSK LQAALDYACG EGDADCQQIQ 60 PGAPCYNPNT LEAHASYAFN SYYEKNSRKI GTCDFAGAAY |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 6.0e-20 | 28 | 100 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-29 | 28 | 100 | 73 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAM66024.1 | 3e-33 | 7 | 100 | 350 | 443 | beta-1,3-glucanase-like protein [Arabidopsis thaliana] |
GenBank | ACN39797.1 | 0 | 1 | 100 | 358 | 457 | unknown [Picea sitchensis] |
DDBJ | BAB08587.1 | 3e-33 | 7 | 100 | 350 | 443 | beta-1,3-glucanase-like protein [Arabidopsis thaliana] |
EMBL | CBI28862.1 | 2e-33 | 27 | 100 | 265 | 338 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001154780.1 | 2e-33 | 7 | 100 | 350 | 443 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000000003 | 28 | 99 | 12 | 82 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO235766 | 100 | 1 | 100 | 0 |
CK440008 | 100 | 1 | 100 | 0 |
CK440367 | 100 | 1 | 100 | 0 |
CK440010 | 100 | 1 | 100 | 0 |
CK440368 | 100 | 1 | 100 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|