CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_530154g0010
FamilyAA2
Protein PropertiesLength: 379 Molecular Weight: 42403.3 Isoelectric Point: 5.6577
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2973580
  IRDQVDKLYHEHGNTAVSWLRTIFHDCMVESCDASILLETTHNLVSEQESERNFGMRNFKYVNAIKNAVEEECPGVVSCADIITLAVREGTVMLGGPRMA
  LKTGRRDSQESSAAVTEKYMPLHNDSLDTVLDRFETLGIDAEGTVALLGAHTVGRTHCVNLVNRLYPTVDPSIDPDYAVYLKGRCPTPNPEPTEVLYSRN
  DPGTPMKFDNNYYKNLMANKGLLLVDQRLLSDNRTSDYVNRMAQDNQYFFSQFERALITLSE
Full Sequence
Protein Sequence     Length: 379     Download
MGKKVRSLIA CQVSPMDEWL RLLRDTAGPT LGTFGTPCVL HSTYTAGRIV KSIMARFELL    60
GIFILLVWKA GNTCTAQQTG LMEGYYQTLC PSAEDIIRDQ VDKLYHEHGN TAVSWLRTIF    120
HDCMVESCDA SILLETTHNL VSEQESERNF GMRNFKYVNA IKNAVEEECP GVVSCADIIT    180
LAVREGTVML GGPRMALKTG RRDSQESSAA VTEKYMPLHN DSLDTVLDRF ETLGIDAEGT    240
VALLGAHTVG RTHCVNLVNR LYPTVDPSID PDYAVYLKGR CPTPNPEPTE VLYSRNDPGT    300
PMKFDNNYYK NLMANKGLLL VDQRLLSDNR TSDYVNRMAQ DNQYFFSQFE RALITLSENN    360
PLTGSLGEIR KDCRYVNSL 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.000231034132+
cd00314plant_peroxidase_like9.0e-2795358297+
pfam00141peroxidase5.0e-5097249154+
PLN03030PLN030302.0e-5654377336+
cd00693secretory_peroxidase5.0e-13880376302+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN97181.107837830330peroxidase [Populus trichocarpa]
EMBLCAA66961.108537734327peroxidase [Arabidopsis thaliana]
RefSeqNP_001118461.10853773296peroxidase 21 (PER21) (P21) (PRXR5) [Arabidopsis thaliana]
RefSeqXP_002275288.108137731327PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326343.107837830330predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0853777304A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1pa2_A0853777304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0813772294A Chain A, Peanut Peroxidase
PDB1sch_A0813772294A Chain A, Peanut Peroxidase
PDB4a5g_B0853778305A Chain A, Raphanus Sativus Anionic Peroxidase.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX371307258392960
CO160524278493260
CO164811276493240
GW7575592611193790
DR088951260813400
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.124250.1Cucsa.307020.3
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna25836.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma10g05800.1Glyma17g01720.1
Glyma07g39020.1Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009704mmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067m
mgv1a019681mmgv1a025816mmgv1a026804m
Oryza sativaLOC_Os07g49360.1LOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s8_186V6.1Pp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1
Pp1s104_177V6.3Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)