| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_556388g0010 |
| Family | CE8 |
| Protein Properties | Length: 93 Molecular Weight: 10525 Isoelectric Point: 6.4791 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 3 | 93 | 2.5e-29 |
| TAVIGQGFLARDITFENTASVGKDFSLGISLSRTRHQTVSLQVVSDLSTFYCFSFKGYQDTLYAHSLRQFYQECYIYGTLDCIFCNAATMF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 93 Download |
| MITAVIGQGF LARDITFENT ASVGKDFSLG ISLSRTRHQT VSLQVVSDLS TFYCFSFKGY 60 QDTLYAHSLR QFYQECYIYG TLDCIFCNAA TMF |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02506 | PLN02506 | 5.0e-28 | 4 | 93 | 90 | + putative pectinesterase/pectinesterase inhibitor | ||
| PLN03043 | PLN03043 | 2.0e-28 | 4 | 93 | 90 | + Probable pectinesterase/pectinesterase inhibitor; Provisional | ||
| PLN02713 | PLN02713 | 1.0e-29 | 4 | 93 | 90 | + Probable pectinesterase/pectinesterase inhibitor | ||
| PLN02916 | PLN02916 | 1.0e-30 | 5 | 93 | 89 | + pectinesterase family protein | ||
| pfam01095 | Pectinesterase | 4.0e-34 | 4 | 93 | 90 | + Pectinesterase. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABQ42392.1 | 4e-24 | 4 | 93 | 365 | 442 | pectin methylesterase-like protein [Taiwania cryptomerioides] |
| GenBank | ABQ45843.1 | 3e-24 | 4 | 93 | 49 | 126 | pectin methylesterase 3 [Citrus unshiu] |
| GenBank | ACN40984.1 | 2e-25 | 4 | 93 | 371 | 448 | unknown [Picea sitchensis] |
| EMBL | CAB82677.1 | 4e-25 | 4 | 93 | 280 | 357 | pectinesterase-like protein [Arabidopsis thaliana] |
| RefSeq | NP_191632.2 | 3e-25 | 4 | 93 | 290 | 367 | pectinesterase family protein [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 5e-21 | 4 | 93 | 90 | 167 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 5e-18 | 4 | 93 | 86 | 163 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 1qjv_B | 0.00001 | 39 | 93 | 129 | 185 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 1qjv_A | 0.00001 | 39 | 93 | 129 | 185 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 2ntq_B | 0.00001 | 39 | 93 | 129 | 185 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| Hydropathy |
|---|
 |
