Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_5970350g0010 |
Family | GH19 |
Protein Properties | Length: 139 Molecular Weight: 13975.3 Isoelectric Point: 4.2493 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 44 | 138 | 6.4e-33 |
VGTIISQSFFDGLAGGAASSCEGKGFYTRDAFIAAANAYSGFGTTGADDVQKRELAAFFANVMHETGGLCSINEINPPQNYCDPSYTAWPCTSGK |
Full Sequence |
---|
Protein Sequence Length: 139 Download |
CGCASGLCCS KYGYCGTTSD YCGDGCQSGP CTGGGPPTGG SGNVGTIISQ SFFDGLAGGA 60 ASSCEGKGFY TRDAFIAAAN AYSGFGTTGA DDVQKRELAA FFANVMHETG GLCSINEINP 120 PQNYCDPSYT AWPCTSGKS |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00035 | ChtBD1 | 0.007 | 3 | 22 | 20 | + Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements. | ||
smart00270 | ChtBD1 | 0.004 | 3 | 22 | 20 | + Chitin binding domain. | ||
pfam00187 | Chitin_bind_1 | 0.003 | 3 | 22 | 20 | + Chitin recognition protein. | ||
pfam00182 | Glyco_hydro_19 | 9.0e-30 | 47 | 138 | 106 | + Chitinase class I. | ||
cd00325 | chitinase_glyco_hydro_19 | 4.0e-32 | 48 | 139 | 106 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK22417.1 | 0 | 1 | 139 | 39 | 176 | unknown [Picea sitchensis] |
GenBank | ABK23018.1 | 0 | 1 | 139 | 39 | 176 | unknown [Picea sitchensis] |
GenBank | ABK23737.1 | 0 | 1 | 139 | 39 | 176 | unknown [Picea sitchensis] |
GenBank | ABR17951.1 | 0 | 1 | 139 | 39 | 177 | unknown [Picea sitchensis] |
GenBank | ACN40402.1 | 0 | 1 | 139 | 39 | 176 | unknown [Picea sitchensis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 0 | 44 | 139 | 2 | 96 | A Chain A, Solution Nmr Structure Of Protein Ne2328 From Nitrosomonas Europaea. Northeast Structural Genomics Consortium Target Net3 |
PDB | 3hbe_X | 0 | 44 | 139 | 2 | 96 | A Chain A, Solution Nmr Structure Of Protein Ne2328 From Nitrosomonas Europaea. Northeast Structural Genomics Consortium Target Net3 |
PDB | 3hbd_A | 0 | 44 | 139 | 2 | 96 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 3iwr_B | 1e-21 | 3 | 139 | 13 | 166 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 3iwr_A | 1e-21 | 3 | 139 | 13 | 166 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AM171094 | 139 | 1 | 139 | 0 |
DR581279 | 139 | 1 | 139 | 0 |
EX433630 | 141 | 1 | 139 | 0 |
GW722266 | 139 | 1 | 139 | 0 |
GW721423 | 139 | 1 | 139 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|