Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_61874g0010 |
Family | GT5 |
Protein Properties | Length: 147 Molecular Weight: 16740.1 Isoelectric Point: 5.7708 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT5 | 3 | 137 | 0 |
ESTYKDRFRGWVGFSVPVAHKITAGCDILLMPSRFEPCGLNQLYAMRYGTVPVVHCTGGLRDTVEDFDPFANEGEGVGTGWRFSPLSKEAMLGTLRIAME TYRRYKSSWEGIMKRGMLQDYTWDNAASQYEQVFE |
Full Sequence |
---|
Protein Sequence Length: 147 Download |
MSESTYKDRF RGWVGFSVPV AHKITAGCDI LLMPSRFEPC GLNQLYAMRY GTVPVVHCTG 60 GLRDTVEDFD PFANEGEGVG TGWRFSPLSK EAMLGTLRIA METYRRYKSS WEGIMKRGML 120 QDYTWDNAAS QYEQVFEWAK IDAPYVP |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK14099 | PRK14099 | 8.0e-34 | 14 | 136 | 123 | + glycogen synthase; Provisional | ||
COG0297 | GlgA | 9.0e-46 | 3 | 139 | 137 | + Glycogen synthase [Carbohydrate transport and metabolism] | ||
PRK00654 | glgA | 2.0e-55 | 6 | 137 | 132 | + glycogen synthase; Provisional | ||
TIGR02095 | glgA | 3.0e-61 | 3 | 137 | 135 | + glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
cd03791 | GT1_Glycogen_synthase_DULL1_like | 2.0e-62 | 3 | 138 | 136 | + This family is most closely related to the GT1 family of glycosyltransferases. Glycogen synthase catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAN37578.1 | 0 | 2 | 146 | 498 | 642 | soluble starch synthase I [Colocasia esculenta] |
GenBank | ACN36715.1 | 0 | 2 | 146 | 225 | 368 | unknown [Zea mays] |
GenBank | EAZ35910.1 | 0 | 2 | 146 | 497 | 640 | hypothetical protein OsJ_20213 [Oryza sativa Japonica Group] |
RefSeq | NP_001056881.1 | 0 | 2 | 146 | 497 | 640 | Os06g0160700 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002321996.1 | 0 | 2 | 146 | 504 | 648 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1rzv_B | 4e-26 | 4 | 137 | 342 | 473 | A Chain A, Crystal Structure Of The Glycogen Synthase From Agrobacterium Tumefaciens (Non-Complexed Form) |
PDB | 1rzv_A | 4e-26 | 4 | 137 | 342 | 473 | A Chain A, Crystal Structure Of The Glycogen Synthase From Agrobacterium Tumefaciens (Non-Complexed Form) |
PDB | 1rzu_B | 4e-26 | 4 | 137 | 342 | 473 | A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp |
PDB | 1rzu_A | 4e-26 | 4 | 137 | 342 | 473 | A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp |
PDB | 3guh_A | 8e-25 | 14 | 142 | 353 | 479 | A Chain A, Crystal Structure Of The Glycogen Synthase From A. Tumefaciens In Complex With Adp |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
ES865982 | 147 | 1 | 147 | 0 |
EX416851 | 147 | 1 | 147 | 0 |
EX312401 | 147 | 1 | 147 | 0 |
DR588066 | 147 | 1 | 147 | 0 |
EX379570 | 147 | 1 | 147 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|