| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_6386331g0010 |
| Family | GH17 |
| Protein Properties | Length: 73 Molecular Weight: 7697.76 Isoelectric Point: 3.9717 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 2 | 72 | 1.7e-22 |
| GINYGQLGDDLPPPEQAVALIKSLGFGQVKIFDSDPNVLRALSNTSLRVVMAATNEELETLAASPAAAAEW | |||
| Full Sequence |
|---|
| Protein Sequence Length: 73 Download |
| MGINYGQLGD DLPPPEQAVA LIKSLGFGQV KIFDSDPNVL RALSNTSLRV VMAATNEELE 60 TLAASPAAAA EWL |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 7.0e-11 | 2 | 52 | 51 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABR16205.1 | 5e-18 | 1 | 73 | 48 | 120 | unknown [Picea sitchensis] |
| RefSeq | NP_001146374.1 | 2e-17 | 1 | 73 | 31 | 103 | hypothetical protein LOC100279952 [Zea mays] |
| RefSeq | NP_001149419.1 | 7e-17 | 1 | 73 | 31 | 103 | glucan endo-1,3-beta-glucosidase 7 [Zea mays] |
| RefSeq | XP_001781801.1 | 4e-17 | 1 | 73 | 1 | 73 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_002456675.1 | 5e-18 | 1 | 73 | 31 | 103 | hypothetical protein SORBIDRAFT_03g040630 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000000004 | 1 | 73 | 1 | 73 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghs_B | 0.000000009 | 1 | 73 | 1 | 73 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghs_A | 0.000000009 | 1 | 73 | 1 | 73 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 3f55_D | 0.00000004 | 1 | 73 | 2 | 73 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 3f55_C | 0.00000004 | 1 | 73 | 2 | 73 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| BF609784 | 52 | 1 | 52 | 6e-25 |
| BM427804 | 52 | 1 | 52 | 8e-25 |
| BX251530 | 52 | 1 | 52 | 1e-24 |
| AA556234 | 52 | 1 | 52 | 7e-24 |
| BX252680 | 52 | 1 | 52 | 1e-22 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |