| Basic Information | |
|---|---|
| Species | Malus domestica |
| Cazyme ID | MDP0000146967 |
| Family | GH17 |
| Protein Properties | Length: 122 Molecular Weight: 13748 Isoelectric Point: 9.343 |
| Chromosome | Chromosome/Scaffold: 003623656 Start: 27242 End: 27696 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 26 | 106 | 3e-22 |
| VGVNYGQLGNNLPPPSQSVKLIQSLKAKRVKLYDANPKILTASNQTLADHWVHTNVVPFYPETLIRYLFVGNEILSQPNKQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 122 Download |
| MELGFLPLLI LCLSVSISSA ELASKVGVNY GQLGNNLPPP SQSVKLIQSL KAKRVKLYDA 60 NPKILTASNQ TLADHWVHTN VVPFYPETLI RYLFVGNEIL SQPNKQIWYN LDILGETSRY 120 YR |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-21 | 26 | 101 | 97 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAF20214.1 | 1e-29 | 15 | 107 | 14 | 127 | AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana] |
| DDBJ | BAA89481.1 | 8e-33 | 5 | 111 | 19 | 146 | beta-1,3-glucanase [Salix gilgiana] |
| EMBL | CAN60692.1 | 5e-30 | 8 | 111 | 1 | 132 | hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002303070.1 | 3e-31 | 6 | 111 | 3 | 129 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002334812.1 | 1e-39 | 1 | 111 | 2 | 133 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000000001 | 26 | 100 | 1 | 96 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 0.000000001 | 25 | 99 | 1 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 0.000000001 | 25 | 99 | 1 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 0.000000001 | 25 | 99 | 1 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 0.000000001 | 25 | 99 | 1 | 95 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 20 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EB151900 | 132 | 1 | 111 | 0 |
| EB154442 | 132 | 1 | 111 | 0 |
| EB130377 | 132 | 1 | 111 | 0 |
| EB127934 | 131 | 1 | 110 | 0 |
| EB126826 | 132 | 1 | 111 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |