y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_6507007g0010 |
Family | GH1 |
Protein Properties | Length: 118 Molecular Weight: 13476.1 Isoelectric Point: 4.5187 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 1 | 115 | 3.20057e-42 |
IEPFITLFHWDLPQALENEYLGFLSQKIVEDFSLFAEECFRAFGDRVKYWVTINEQLYFSYLGYDDGSEAPGRCSPGFGNCTEGDSATEPYIVAHNMLLA HSAAVKIYKTKYQVQ |
Full Sequence |
---|
Protein Sequence Length: 118 Download |
IEPFITLFHW DLPQALENEY LGFLSQKIVE DFSLFAEECF RAFGDRVKYW VTINEQLYFS 60 YLGYDDGSEA PGRCSPGFGN CTEGDSATEP YIVAHNMLLA HSAAVKIYKT KYQVQQKG 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG2723 | BglB | 2.0e-31 | 1 | 109 | 109 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
pfam00232 | Glyco_hydro_1 | 4.0e-38 | 1 | 113 | 113 | + Glycosyl hydrolase family 1. | ||
PLN02998 | PLN02998 | 2.0e-43 | 1 | 114 | 115 | + beta-glucosidase | ||
PLN02849 | PLN02849 | 3.0e-44 | 1 | 118 | 118 | + beta-glucosidase | ||
PLN02814 | PLN02814 | 3.0e-45 | 1 | 118 | 119 | + beta-glucosidase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK26114.1 | 0 | 1 | 115 | 46 | 160 | unknown [Picea sitchensis] |
GenBank | ABR17782.1 | 0 | 1 | 118 | 46 | 163 | unknown [Picea sitchensis] |
RefSeq | XP_002330883.1 | 0 | 1 | 118 | 138 | 255 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002512137.1 | 0 | 1 | 118 | 158 | 275 | beta-glucosidase, putative [Ricinus communis] |
RefSeq | XP_002512147.1 | 0 | 1 | 118 | 48 | 166 | beta-glucosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3gnr_A | 2.00386e-43 | 1 | 118 | 124 | 242 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 3gnp_A | 2.00386e-43 | 1 | 118 | 124 | 242 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
PDB | 3gno_A | 2.00386e-43 | 1 | 118 | 124 | 242 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptq_B | 8.00001e-42 | 1 | 118 | 144 | 262 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3ptq_A | 8.00001e-42 | 1 | 118 | 144 | 262 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX343190 | 118 | 1 | 118 | 0 |
EX326406 | 118 | 1 | 118 | 0 |
DR451767 | 118 | 1 | 118 | 0 |
EX423880 | 118 | 1 | 118 | 0 |
DR094305 | 118 | 1 | 118 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|