| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_6742g0010 |
| Family | GH17 |
| Protein Properties | Length: 101 Molecular Weight: 11040.8 Isoelectric Point: 9.006 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 2 | 92 | 4.6e-28 |
| GVNWGTLSSQRLAPSIVVKLLQANHIMKVKLFDADPMVLEALMGSGIQVMVGISNDLLGTISSSSAAADLWVRDNVLRYVFKDGVNIRYLH | |||
| Full Sequence |
|---|
| Protein Sequence Length: 101 Download |
| MGVNWGTLSS QRLAPSIVVK LLQANHIMKV KLFDADPMVL EALMGSGIQV MVGISNDLLG 60 TISSSSAAAD LWVRDNVLRY VFKDGVNIRY LHLTSSTSYW G |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-16 | 2 | 90 | 89 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001141759.1 | 1e-30 | 1 | 101 | 28 | 131 | hypothetical protein LOC100273895 [Zea mays] |
| RefSeq | XP_002271875.1 | 5e-30 | 1 | 101 | 39 | 142 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002329964.1 | 2e-31 | 1 | 101 | 29 | 132 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002459936.1 | 5e-30 | 1 | 101 | 28 | 131 | hypothetical protein SORBIDRAFT_02g017290 [Sorghum bicolor] |
| RefSeq | XP_002525026.1 | 3e-30 | 1 | 91 | 26 | 116 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000002 | 1 | 91 | 1 | 89 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghs_B | 0.000000004 | 1 | 91 | 1 | 89 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghs_A | 0.000000004 | 1 | 91 | 1 | 89 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghr_A | 0.00000002 | 1 | 91 | 1 | 88 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1aq0_B | 0.00000002 | 1 | 91 | 1 | 88 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EX414444 | 100 | 1 | 100 | 0 |
| EX414075 | 100 | 1 | 100 | 0 |
| GT052096 | 91 | 1 | 91 | 0 |
| EX354587 | 104 | 1 | 101 | 0 |
| DT767244 | 104 | 1 | 101 | 3e-36 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |