y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_675870g0010 |
Family | GT5 |
Protein Properties | Length: 147 Molecular Weight: 16480.1 Isoelectric Point: 9.5338 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT5 | 3 | 143 | 0 |
YTKENVVEGKRAAKEELQRRLGLKQDDRPLVGIITRLTAQKGVHLIKHGIWRTIDRSGQIVLLGSAPDPRIQNEFSNLANQLHNTKGDMARLCLTYNEPL SHLIYAGADFILIPSMFEPCGLTQLTAMRYGAIPIVRKTGG |
Full Sequence |
---|
Protein Sequence Length: 147 Download |
MAYTKENVVE GKRAAKEELQ RRLGLKQDDR PLVGIITRLT AQKGVHLIKH GIWRTIDRSG 60 QIVLLGSAPD PRIQNEFSNL ANQLHNTKGD MARLCLTYNE PLSHLIYAGA DFILIPSMFE 120 PCGLTQLTAM RYGAIPIVRK TGGELWE 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02939 | PLN02939 | 2.0e-54 | 7 | 143 | 139 | + transferase, transferring glycosyl groups | ||
TIGR02095 | glgA | 4.0e-55 | 3 | 143 | 142 | + glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
PRK00654 | glgA | 5.0e-61 | 3 | 143 | 141 | + glycogen synthase; Provisional | ||
cd03791 | GT1_Glycogen_synthase_DULL1_like | 3.0e-63 | 7 | 143 | 138 | + This family is most closely related to the GT1 family of glycosyltransferases. Glycogen synthase catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms. | ||
PLN02316 | PLN02316 | 2.0e-96 | 3 | 143 | 141 | + synthase/transferase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABD77100.1 | 0 | 1 | 143 | 224 | 366 | chloroplast starch synthase III [Arabidopsis thaliana] |
GenBank | ABF69970.1 | 0 | 1 | 143 | 116 | 258 | soluble glycogen [starch] synthase, chloroplast, putative, 5' partial [Musa acuminata] |
GenBank | ACT83376.1 | 0 | 1 | 143 | 1003 | 1145 | soluble starch synthase [Solanum tuberosum] |
EMBL | CBI23240.1 | 0 | 1 | 143 | 821 | 963 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002518476.1 | 0 | 1 | 143 | 833 | 975 | starch synthase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3d1j_A | 6e-29 | 3 | 143 | 265 | 400 | A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40 |
PDB | 3guh_A | 8e-29 | 3 | 143 | 265 | 400 | A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40 |
PDB | 2r4u_A | 8e-29 | 3 | 143 | 265 | 400 | A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40 |
PDB | 2r4t_A | 8e-29 | 3 | 143 | 265 | 400 | A Chain A, Crystal Structure Of E.Coli Gs Mutant Dmgs(C7s;c40 |
PDB | 2qzs_A | 8e-29 | 3 | 143 | 265 | 400 | A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb) |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GW761737 | 138 | 6 | 143 | 0 |
FN711349 | 143 | 1 | 143 | 0 |
FE441805 | 143 | 1 | 143 | 0 |
EE076718 | 141 | 3 | 143 | 0 |
CO082100 | 143 | 1 | 143 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|