y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPicea abies
Cazyme IDMA_74967g0010
FamilyCE13
Protein PropertiesLength: 277 Molecular Weight: 31157.3 Isoelectric Point: 6.3363
View CDS
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE13941942.2e-34
  VTHEEALHENEVLVLMKMSRPPFHLHTKNRIXYCDGSSFTGDVEEVDPGSKLHLRGQRIWQAVMGDLLAQGMDKAKQALLTGCSAGGLATFIHCDQFKAL
  L
Full Sequence
Protein Sequence     Length: 277     Download
MQHDETLASV FPLDQDKYVR IPFHTGVISN KRKSCEEGYQ PIEVKKELPH DSIEDNKVFI    60
EETDPQKVSH GEEEYELLHE CTKCFDERHI VKNVTHEEAL HENEVLVLMK MSRPPFHLHT    120
KNRIXYCDGS SFTGDVEEVD PGSKLHLRGQ RIWQAVMGDL LAQGMDKAKQ ALLTGCSAGG    180
LATFIHCDQF KALLTGCSAG GLATFIHCDQ FSDLLPNRAK VKCMPDAGFF LDSEDVAGRI    240
FKTLSRCLHI KNASCKSGSM TFISSFHLKF CYDTPSL                             300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03283PAE2.0e-46114239126+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93778.13e-348423879214unknown [Populus trichocarpa]
GenBankACG39759.12e-37113238111215carboxylic ester hydrolase [Zea mays]
RefSeqNP_001047850.11e-34113238110214Os02g0702400 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151183.12e-37113238111215LOC100284816 [Zea mays]
RefSeqXP_002454426.17e-37113238111215hypothetical protein SORBIDRAFT_04g030720 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO1594351341052380
CO1697821251142380
DV9717471301092386.02558e-44
GE4745301301092383.9937e-43
CO159435492302717.1
Orthologous Group
SpeciesID
Arabidopsis lyrata906276
Picea abiesMA_10389648g0010MA_10376612g0010MA_10389235g0010MA_10432132g0010MA_97009g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny