| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_79718g0010 |
| Family | GH9 |
| Protein Properties | Length: 140 Molecular Weight: 15420.5 Isoelectric Point: 4.6315 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH9 | 30 | 140 | 3.69943e-42 |
| NYRDALSKSILFFEGQRSGKLPANQRLNWRKDSALADGSDENVDLEGGYYDAGDNLKFGFPMAFTTTMLSWSVIEFGRAMGDELENAKNSIRWATDYLLK AAAYPDTLYVQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 140 Download |
| MGTGLSQCLL AMLVSSLVLQ GAMAGTVFHN YRDALSKSIL FFEGQRSGKL PANQRLNWRK 60 DSALADGSDE NVDLEGGYYD AGDNLKFGFP MAFTTTMLSW SVIEFGRAMG DELENAKNSI 120 RWATDYLLKA AAYPDTLYVQ |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02171 | PLN02171 | 3.0e-52 | 9 | 138 | 132 | + endoglucanase | ||
| PLN00119 | PLN00119 | 3.0e-55 | 1 | 140 | 143 | + endoglucanase | ||
| pfam00759 | Glyco_hydro_9 | 1.0e-57 | 30 | 140 | 113 | + Glycosyl hydrolase family 9. | ||
| PLN02308 | PLN02308 | 4.0e-64 | 9 | 140 | 132 | + endoglucanase | ||
| PLN02266 | PLN02266 | 5.0e-68 | 29 | 140 | 112 | + endoglucanase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAA85150.1 | 0 | 29 | 140 | 41 | 152 | endo-1,4-beta-glucanase [Pisum sativum] |
| RefSeq | NP_192138.1 | 0 | 29 | 140 | 51 | 162 | AtGH9B13 (Arabidopsis thaliana glycosyl hydrolase 9B13); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds |
| RefSeq | XP_002271736.1 | 0 | 29 | 140 | 46 | 157 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002320998.1 | 0 | 29 | 140 | 45 | 156 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002523114.1 | 0 | 29 | 140 | 45 | 156 | endo-1,4-beta-glucanase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4tf4_B | 7e-36 | 30 | 140 | 5 | 117 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 4tf4_A | 7e-36 | 30 | 140 | 5 | 117 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3tf4_B | 7e-36 | 30 | 140 | 5 | 117 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3tf4_A | 7e-36 | 30 | 140 | 5 | 117 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1tf4_B | 7e-36 | 30 | 140 | 5 | 117 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
