| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_8122188g0010 |
| Family | GH29 |
| Protein Properties | Length: 163 Molecular Weight: 18489.4 Isoelectric Point: 4.4395 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH29 | 2 | 151 | 0 |
| AMFLHFGMNTFTDSEWGSGQADPWLFNPTDSLDARQWASVAKEAGFSHIILTAKHHDGFCLWPSAYTNYSVSSSPWKNGTGDVVQDVAEAAREAGIGLGL YLSPWDRHESSYGQTLRYNEYYLAQLRELLTNYGTIEEVWLDGAKGKDAK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 163 Download |
| MAMFLHFGMN TFTDSEWGSG QADPWLFNPT DSLDARQWAS VAKEAGFSHI ILTAKHHDGF 60 CLWPSAYTNY SVSSSPWKNG TGDVVQDVAE AAREAGIGLG LYLSPWDRHE SSYGQTLRYN 120 EYYLAQLREL LTNYGTIEEV WLDGAKGKDA KSMEYYFDEW FSV |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam01120 | Alpha_L_fucos | 1.0e-24 | 26 | 156 | 145 | + Alpha-L-fucosidase. | ||
| smart00812 | Alpha_L_fucos | 3.0e-26 | 26 | 144 | 132 | + Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis. | ||
| COG3669 | COG3669 | 3.0e-40 | 4 | 161 | 168 | + Alpha-L-fucosidase [Carbohydrate transport and metabolism] | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_180377.2 | 0 | 1 | 163 | 50 | 211 | ATFUC1 (alpha-L-fucosidase 1); alpha-L-fucosidase [Arabidopsis thaliana] |
| Swiss-Prot | Q8GW72 | 0 | 1 | 163 | 50 | 211 | FUCO1_ARATH RecName: Full=Alpha-L-fucosidase 1; AltName: Full=Alpha-L-fucoside fucohydrolase; AltName: Full=Alpha-1,3/4-fucosidase; Short=AtFUC1; Flags: Precursor |
| RefSeq | XP_002270674.1 | 0 | 1 | 163 | 28 | 190 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002313533.1 | 0 | 1 | 163 | 26 | 187 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002523703.1 | 0 | 1 | 163 | 75 | 236 | alpha-l-fucosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3mo4_B | 0 | 1 | 163 | 33 | 196 | A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697 |
| PDB | 3mo4_A | 0 | 1 | 163 | 33 | 196 | A Chain A, The Crystal Structure Of An Alpha-(1-3,4)-Fucosidase From Bifidobacterium Longum Subsp. Infantis Atcc 15697 |
| PDB | 3ues_B | 0 | 1 | 163 | 31 | 194 | A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin |
| PDB | 3ues_A | 0 | 1 | 163 | 31 | 194 | A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis Complexed With Deoxyfuconojirimycin |
| PDB | 3uet_B | 0 | 1 | 163 | 31 | 194 | A Chain A, Crystal Structure Of Alpha-1,34-Fucosidase From Bifidobacterium Longum Subsp. Infantis D172aE217A MUTANT COMPLEXED WITH LACTO-N- Fucopentaose Ii |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CV031436 | 163 | 1 | 163 | 0 |
| GT255494 | 161 | 1 | 161 | 0 |
| GO096131 | 163 | 1 | 163 | 0 |
| CT582125 | 193 | 1 | 163 | 0 |
| DR101622 | 135 | 1 | 135 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
