Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_84359g0010 |
Family | GT1 |
Protein Properties | Length: 138 Molecular Weight: 14821.1 Isoelectric Point: 8.7728 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 6 | 104 | 1.5e-29 |
HVDFYALVHHGGAGTTAAGLKAGCPTTIVPFFGDQPFWGERVHARGLGPSPIPVDQFSLAKLVDAIQIMLNPQVKESADAMSKAMENEDGVSGAVKAFH |
Full Sequence |
---|
Protein Sequence Length: 138 Download |
MRQITHVDFY ALVHHGGAGT TAAGLKAGCP TTIVPFFGDQ PFWGERVHAR GLGPSPIPVD 60 QFSLAKLVDA IQIMLNPQVK ESADAMSKAM ENEDGVSGAV KAFHKQLPKK MPQPLPLPTE 120 HGRIDSFFRG VGKVFGCA |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG1819 | COG1819 | 5.0e-8 | 30 | 104 | 76 | + Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] |
cd03784 | GT1_Gtf_like | 2.0e-17 | 29 | 104 | 76 | + This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAC22616.1 | 0 | 11 | 138 | 488 | 609 | UDP-glucose:sterol 3-O-glucosyltransferase [Panax ginseng] |
DDBJ | BAC22617.1 | 0 | 11 | 138 | 481 | 602 | UDP-glucose:sterol 3-O-glucosyltransferase [Panax ginseng] |
EMBL | CAD39328.2 | 0 | 11 | 138 | 182 | 307 | OSJNBb0080H08.20 [Oryza sativa (japonica cultivar-group)] |
GenBank | EEE60429.1 | 0 | 11 | 138 | 171 | 296 | hypothetical protein OsJ_13634 [Oryza sativa Japonica Group] |
RefSeq | XP_002521125.1 | 0 | 11 | 138 | 502 | 626 | transferase, transferring glycosyl groups, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3h4t_A | 0.000000004 | 11 | 110 | 287 | 384 | A Chain A, 1.7 A Resolution Structure Of The Soluble Lytic Transglycosylase Slt35 From Escherichia Coli |
PDB | 3h4i_A | 0.000000004 | 11 | 110 | 287 | 384 | A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products |
PDB | 1iir_A | 0.00000002 | 11 | 112 | 304 | 403 | A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb |
PDB | 1rrv_B | 0.0000007 | 4 | 87 | 291 | 380 | A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin. |
PDB | 1rrv_A | 0.0000007 | 4 | 87 | 291 | 380 | A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin. |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
ES257872 | 110 | 29 | 138 | 0 |
ES256973 | 110 | 29 | 138 | 0 |
CO203899 | 110 | 29 | 138 | 0 |
CO233670 | 110 | 29 | 138 | 0 |
ES254784 | 110 | 29 | 138 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |