| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_8478g0010 |
| Family | GH17 |
| Protein Properties | Length: 149 Molecular Weight: 16121.1 Isoelectric Point: 10.6571 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 36 | 125 | 1.6e-28 |
| LGVNWGTLSSHRLSPAIVVNMLQANNITKVKIFDADPKVLQALTGTKIHVTVGIPNEMLHTLSKSKVAARSWVHDNVTRYAFKGGVDIRT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 149 Download |
| MGSSIVLVSK CLFCLWVSLH FMLPIVAVLG GGGGGLGVNW GTLSSHRLSP AIVVNMLQAN 60 NITKVKIFDA DPKVLQALTG TKIHVTVGIP NEMLHTLSKS KVAARSWVHD NVTRYAFKGG 120 VDIRTLSKFP PASPKKRGLV IEVYYFTFA |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-16 | 38 | 116 | 79 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABN08871.1 | 1e-28 | 36 | 127 | 7 | 98 | Glycoside hydrolase, family 17; X8 [Medicago truncatula] |
| EMBL | CBI28434.1 | 9e-29 | 35 | 120 | 22 | 107 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002269108.1 | 7e-30 | 21 | 120 | 11 | 110 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002313970.1 | 7e-29 | 35 | 124 | 21 | 110 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002515703.1 | 1e-29 | 35 | 124 | 7 | 96 | Glucan endo-1,3-beta-glucosidase, acidic isoform PR-O, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.0000000007 | 36 | 115 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 0.00000001 | 36 | 138 | 2 | 101 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 0.00000001 | 36 | 138 | 2 | 101 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 0.00000001 | 36 | 138 | 2 | 101 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 0.00000001 | 36 | 138 | 2 | 101 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 12 | 34 | |||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CT575454 | 127 | 1 | 127 | 0 |
| GW741245 | 62 | 66 | 127 | 0 |
| GW741245 | 73 | 1 | 73 | 0 |
| DT597846 | 90 | 38 | 127 | 1e-32 |
| EX414444 | 89 | 38 | 126 | 2e-32 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |